SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296500999|ref|YP_003662699.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296500999|ref|YP_003662699.1|
Domain Number 1 Region: 34-270
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.26e-78
Family Phosphate binding protein-like 0.00000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296500999|ref|YP_003662699.1|
Sequence length 270
Comment ABC transporter substrate-binding protein [Bacillus thuringiensis BMB171]
Sequence
MKKVLLSIVSGAVLLLGACSVSSDKEVKELDEKKITVGVTGGPHEQIFEKVKEVAAKDGL
EIDIKVFNDYVAPNVSLDEKSLDVNSYQTKSYLDVFKAERNMKLAEVFSTVTFPMGVYSK
DIKDVKDLKEGDAIAVPNDPTNELRALKLFEKAGVLKVDPKATEKATAKDVIENPKKLKI
VELEASQLPTQLSEVKAAAINTNFALGAKLSPAKDSIFREGKDSPYVNWVVVRTENKDDA
VVNKLKKAYQSKEVKEFIEKKFDGSVLPSW
Download sequence
Identical sequences A0A0T8YJR4 A0A1J9V7L0 A0A229M3Y4 A0A243DY10 C2U880 J8LF52 R8GHX5
WP_000756994.1.20208 WP_000756994.1.20651 WP_000756994.1.22084 WP_000756994.1.33201 WP_000756994.1.41518 WP_000756994.1.4355 WP_000756994.1.44956 WP_000756994.1.54240 WP_000756994.1.55116 WP_000756994.1.56320 WP_000756994.1.60153 WP_000756994.1.65803 WP_000756994.1.67001 WP_000756994.1.67912 WP_000756994.1.71114 WP_000756994.1.73790 WP_000756994.1.83666 WP_000756994.1.87768 WP_000756994.1.88200 WP_000756994.1.98604 gi|296500999|ref|YP_003662699.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]