SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296501182|ref|YP_003662882.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296501182|ref|YP_003662882.1|
Domain Number 1 Region: 1-255
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.84e-70
Family Phosphate binding protein-like 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296501182|ref|YP_003662882.1|
Sequence length 264
Comment cystine-binding protein [Bacillus thuringiensis BMB171]
Sequence
MKRKLLTIVASITLCTSFILGACSKESSTTSSNSEKEFRYAMSGLYKPFNYKENDGKLVG
FDVEIGEALAKKMNMKATPVTNPWETLIQGLQAKKYDVILGSMAITEERLKAVSFSNPYY
RSGAQIFVAKKNTAISSPEDLKGKKIGVVKASTFKNLVAKYTDQITEYDSDITALMDLEP
GRVDAVITDQMVGLRMIKEGKSKIKEAGKPLNLDEMGIAIRKDDKEMVEKVNKALDEIIK
DGTYEKISKKWFGRNILGEEEKTK
Download sequence
Identical sequences A0A0T8J5K3 A0A164TDB4 A0A1M6NDF2 A0A1Q9KUR9 A0A1Y0TSE5 A0A229MAU7 A0A243L0K5 A0A243LH53 A0A2C9YTE7 C2SVN1 C2U8P4 J8LKQ1 J8MHD1 Q81II5 R8GZ96
gi|296501182|ref|YP_003662882.1| 226900.BC0402 NP_830241.1.86172 WP_000823765.1.100912 WP_000823765.1.12553 WP_000823765.1.14006 WP_000823765.1.14176 WP_000823765.1.19438 WP_000823765.1.20208 WP_000823765.1.22699 WP_000823765.1.25290 WP_000823765.1.25599 WP_000823765.1.26637 WP_000823765.1.28237 WP_000823765.1.32784 WP_000823765.1.32927 WP_000823765.1.33201 WP_000823765.1.33717 WP_000823765.1.38345 WP_000823765.1.40034 WP_000823765.1.41464 WP_000823765.1.41518 WP_000823765.1.44956 WP_000823765.1.46326 WP_000823765.1.4964 WP_000823765.1.5025 WP_000823765.1.51072 WP_000823765.1.55116 WP_000823765.1.56320 WP_000823765.1.57732 WP_000823765.1.58822 WP_000823765.1.59058 WP_000823765.1.60153 WP_000823765.1.6304 WP_000823765.1.64282 WP_000823765.1.67001 WP_000823765.1.67912 WP_000823765.1.6846 WP_000823765.1.68562 WP_000823765.1.71114 WP_000823765.1.73396 WP_000823765.1.73790 WP_000823765.1.76155 WP_000823765.1.76902 WP_000823765.1.80126 WP_000823765.1.85592 WP_000823765.1.86637 WP_000823765.1.88154 WP_000823765.1.88200 WP_000823765.1.90254 WP_000823765.1.90352 WP_000823765.1.96437 WP_000823765.1.97262 WP_000823765.1.98604 gi|30018610|ref|NP_830241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]