SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296501205|ref|YP_003662905.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296501205|ref|YP_003662905.1|
Domain Number 1 Region: 37-320
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.18e-44
Family Phosphate binding protein-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296501205|ref|YP_003662905.1|
Sequence length 332
Comment hydroxymethylpyrimidine-binding protein [Bacillus thuringiensis BMB171]
Sequence
MKKGLKVMLAALVAVGVAGCNPAKKEESASKDQKVKVVLDWFPNTNHTGLYVAQTKDYYK
KQGLDVEIIQPGDNVTAEQMIASGKADFAISAQENVTLARVEGIPVVSVGAIIQHNTSAF
ASLKKDNMTSPKDFEGKRYGGWGGPAEEATLKTIMDKHQADFNKVEKIILGQTDFFKSIG
RDADFEWIYYGWDGIEAKRQGKELNTIMVKDLDPALDFYSPVIITSEKHTKQDKDFVKKF
MSATTEGYNFAIKEPKEAADILIKAVPDVNKDLVQESQKWLSTKYQDDAKAWGVQKEEIW
TNYMNFLYDNKVIKKKIDVKDAFTNEFLPSEK
Download sequence
Identical sequences A0A023P181 A0A0A3VWX5 A0A0G4D8Z8 A0A0T8CQC8 A0A0W7Y3N0 A0A1E7ZYC4 A0A1H6B8J0 A0A1M6NC73 A0A1M7JWX9 A0A229MAN5 A0A242ZES4 A0A243EZV9 A0A243FG43 A0A243FSS6 A0A243HRQ5 A0A243INQ5 A0A243JF97 A0A243L0J0 A0A2A2PCN9 A0A2A9HTZ9 A0A2C9YTD3 B5UIM5 B7H7I1 J7ZRU5 J8E9K3 J8LG09 J8LZI6 J9B981 N1LV35 R8GZH1 R8UFY9 S3J8T3
gi|218233820|ref|YP_002365225.1| gi|296501205|ref|YP_003662905.1| WP_000715573.1.100082 WP_000715573.1.10055 WP_000715573.1.100912 WP_000715573.1.101224 WP_000715573.1.10745 WP_000715573.1.11521 WP_000715573.1.12553 WP_000715573.1.13975 WP_000715573.1.14039 WP_000715573.1.14174 WP_000715573.1.14176 WP_000715573.1.19438 WP_000715573.1.20208 WP_000715573.1.20651 WP_000715573.1.23307 WP_000715573.1.23652 WP_000715573.1.25599 WP_000715573.1.26513 WP_000715573.1.26637 WP_000715573.1.26826 WP_000715573.1.28237 WP_000715573.1.31221 WP_000715573.1.3180 WP_000715573.1.32927 WP_000715573.1.33201 WP_000715573.1.34061 WP_000715573.1.3798 WP_000715573.1.3925 WP_000715573.1.39957 WP_000715573.1.40034 WP_000715573.1.40818 WP_000715573.1.41090 WP_000715573.1.41464 WP_000715573.1.41518 WP_000715573.1.42485 WP_000715573.1.44348 WP_000715573.1.4447 WP_000715573.1.44956 WP_000715573.1.45317 WP_000715573.1.47000 WP_000715573.1.47437 WP_000715573.1.47975 WP_000715573.1.51072 WP_000715573.1.54142 WP_000715573.1.54240 WP_000715573.1.54547 WP_000715573.1.54736 WP_000715573.1.55116 WP_000715573.1.56320 WP_000715573.1.57732 WP_000715573.1.58822 WP_000715573.1.60153 WP_000715573.1.60334 WP_000715573.1.61243 WP_000715573.1.6304 WP_000715573.1.63789 WP_000715573.1.63902 WP_000715573.1.64568 WP_000715573.1.65803 WP_000715573.1.67001 WP_000715573.1.67873 WP_000715573.1.67912 WP_000715573.1.6816 WP_000715573.1.6846 WP_000715573.1.68562 WP_000715573.1.71114 WP_000715573.1.71242 WP_000715573.1.72752 WP_000715573.1.73396 WP_000715573.1.73457 WP_000715573.1.73594 WP_000715573.1.73790 WP_000715573.1.74863 WP_000715573.1.75866 WP_000715573.1.7593 WP_000715573.1.75942 WP_000715573.1.76086 WP_000715573.1.76902 WP_000715573.1.77402 WP_000715573.1.80126 WP_000715573.1.81773 WP_000715573.1.85348 WP_000715573.1.85592 WP_000715573.1.86619 WP_000715573.1.86763 WP_000715573.1.869 WP_000715573.1.87768 WP_000715573.1.88154 WP_000715573.1.88200 WP_000715573.1.88269 WP_000715573.1.90254 WP_000715573.1.90352 WP_000715573.1.90452 WP_000715573.1.90466 WP_000715573.1.91367 WP_000715573.1.93683 WP_000715573.1.93838 WP_000715573.1.94308 WP_000715573.1.9533 WP_000715573.1.95576 WP_000715573.1.96272 WP_000715573.1.96287 WP_000715573.1.96437 WP_000715573.1.97082 WP_000715573.1.97561 WP_000715573.1.97670 WP_000715573.1.97993 WP_000715573.1.98604 WP_000715573.1.99212 WP_000715573.1.99636 405532.BCB4264_A0447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]