SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296501465|ref|YP_003663165.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296501465|ref|YP_003663165.1|
Domain Number 1 Region: 48-296
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.55e-70
Family Phosphate binding protein-like 0.0000507
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296501465|ref|YP_003663165.1|
Sequence length 300
Comment phosphate-binding protein [Bacillus thuringiensis BMB171]
Sequence
MVMKKGIKFSLAALVVAGALVGCGKAEDTTSKDTAKGSDNTKQELSGTIAAAGSTALLPL
AEEAGKKFMEKNSKVSIQVQGGGSGTGINQVASGAVQIGNSDVPSGDKIKDAEKAKELVD
NKVAGIAFALVVNKDVKVDNLTMQQVQDIFTGKVTNWKEVGGKDEKINVINRPASSGTRA
TFEKTIMKDAKINDGTGTTQDSNGAVEQAINSTPGSVSYLAMSYMVGEKKGALQTVKIDG
AEPKVENIASGKYPFWSYEYMVTKGEAKEATKAYIDYVKGKDFEKQVEDMGYIPMSKLNK
Download sequence
Identical sequences A0A0D1QX81 A0A0J7GWW1 A0A0T8MPX0 A0A1M6NN20 A0A1Q9KVK6 A0A1Y0TRD2 A0A243K732 A0A243LX09 B7HDD6 J8L627 J8MXL2 J8NKG3 N1LJ77 R8GYL2 R8UDM7
405532.BCB4264_A0750 gi|296501465|ref|YP_003663165.1| gi|218232160|ref|YP_002365510.1| WP_000245108.1.1354 WP_000245108.1.22699 WP_000245108.1.47975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]