SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296501800|ref|YP_003663500.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296501800|ref|YP_003663500.1|
Domain Number 1 Region: 44-350
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.06e-92
Family Phosphate binding protein-like 0.00000000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296501800|ref|YP_003663500.1|
Sequence length 351
Comment sulfate-binding protein [Bacillus thuringiensis BMB171]
Sequence
MKKWGKAAFMKSTGVLLSAVVLLSGCGSATSTSNSEGSGDKKTVELLNVSYDPTRELYQD
FNKDFAKYWKEKHGQTVNVKQSHGGSGSQARSVIDGLEADVVTLALAYDIDAISKKKQLA
EDWQKRLANNSTPYTSTIVFLVRKGNPKGIKDWDDLTKKGVSVITPNPKTSGGARWNYLA
AWGYALKKYNNSEDKAKEFVSQIYKNVEVLDSGARGATTTFVEKGIGDVLIAWENEALLS
QKELGKDKFEIVTPSISVLAEPPVAVVDKVVDKKGTKKVAEGYLEYLYSEKGQEIAAKNF
YRPRNEKVAEKYASQFPKVQLFTVDELFGGWKKAQEKHFNDGGVFDKIYQK
Download sequence
Identical sequences A0A0D0RDK4 A0A0D0RF33 A0A1M6GVT7 A0A243D3T9 A0A243DM99 A0A2B0K9Y9 J8N0F0
gi|296501800|ref|YP_003663500.1| WP_000758695.1.10584 WP_000758695.1.14006 WP_000758695.1.14176 WP_000758695.1.17797 WP_000758695.1.19438 WP_000758695.1.25599 WP_000758695.1.32784 WP_000758695.1.32927 WP_000758695.1.34125 WP_000758695.1.41464 WP_000758695.1.41518 WP_000758695.1.4964 WP_000758695.1.59058 WP_000758695.1.6304 WP_000758695.1.64282 WP_000758695.1.6846 WP_000758695.1.71114 WP_000758695.1.85592 WP_000758695.1.96437 WP_000758695.1.99212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]