SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296501969|ref|YP_003663669.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296501969|ref|YP_003663669.1|
Domain Number 1 Region: 28-345
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.06e-91
Family Phosphate binding protein-like 0.00000068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296501969|ref|YP_003663669.1|
Sequence length 349
Comment spermidine/putrescine-binding protein [Bacillus thuringiensis BMB171]
Sequence
MKLMKRIAGAAISFSLVAGVLAGCGEKKEELNIYSWADNFDEQVLKDFEKKYNVKINYDK
YASNEEMLAKLQAGGAKYDLIQPSDYMVKTMAKMDLLAPLDKKNIPNIENMVSNFKTPAF
DPENKYSLVYTWGVTGIAYNKKYVKEAPTSWADLWNEKYKGHVTLLNDSREVLGMGLKKH
GFSNSTKDDAQLKTAADDLKKLLPNLLAFDTDNIKQKFITEDAWIGTVWSGDAAFIAKDN
KDVEYVVPKEGGTIWADTLAIPKGAKHKELAEKFMNYLLDEKVSVKNYESIGYSNPNEKA
HPLHSKEYRDNHMIFLTKEELDRTEWLVDVDDKLKDYDRYWTELKTKGK
Download sequence
Identical sequences A0A0T8MSF8 A0A1M6H6R4 A0A1Y0TFG4 A0A1Y5ZPN5 A0A229M912 A0A243DMR9 J8LWT9 J8NU24 R8HAK1
gi|296501969|ref|YP_003663669.1| WP_000772484.1.100912 WP_000772484.1.14176 WP_000772484.1.19438 WP_000772484.1.20208 WP_000772484.1.20651 WP_000772484.1.25599 WP_000772484.1.32927 WP_000772484.1.33201 WP_000772484.1.41464 WP_000772484.1.41518 WP_000772484.1.51072 WP_000772484.1.55116 WP_000772484.1.59997 WP_000772484.1.60153 WP_000772484.1.6304 WP_000772484.1.67001 WP_000772484.1.67912 WP_000772484.1.6846 WP_000772484.1.68562 WP_000772484.1.71114 WP_000772484.1.73396 WP_000772484.1.73790 WP_000772484.1.80126 WP_000772484.1.85592 WP_000772484.1.86637 WP_000772484.1.88200 WP_000772484.1.96437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]