SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296502002|ref|YP_003663702.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296502002|ref|YP_003663702.1|
Domain Number 1 Region: 40-348
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.01e-70
Family Phosphate binding protein-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296502002|ref|YP_003663702.1|
Sequence length 358
Comment 2-aminoethylphosphonate-binding protein [Bacillus thuringiensis BMB171]
Sequence
MKKTIFKAVATGMVFSLLMGCGAKKEESAGAKVKDDKLSGSLTVYTAIEEELVPIYLDSF
KKKYPDVKLNIVRDSTGVITAKLLAEGKNTQADVVWGTAASSLLALDKKDMLKGYSPKGA
DRVLPQFKDDKQPEKWVGNTAFMTGIAVNKEELKKKNLPMPESYEDLTKPEYKGTLVMPH
PASSGTGFLTVSAWLQIMGEDKGWDYMKKLHDNMASYTHSGSKPAKLAGAGEYPVGVSMV
YSALKEKQKGAPVEVVLPKEGLGWEVEANALIKKDNAKNDKLAQAFLDWAITDDVMKLYF
EKNGFATIKNDYKLPEGFPKDVTEKLYKKNDFKWAAENRDKILEKWEKEFGQKAEPKK
Download sequence
Identical sequences A0A0D1NFM5 A0A0G4D650 A0A0J6Z1W5 A0A1B1L2Q0 A0A1C9BQJ6 A0A1I3ZUE6 A0A1M6H901 A0A1M7B2G7 A0A229M9Q7 A0A242ZSG5 A0A243DCZ9 A0A243DQK4 A0A243E2L4 A0A243EMJ9 A0A243FU01 A0A243HKX6 A0A243K094 A0A243LUU0 A0A2A2PAH0 A0A2A9I1N2 C2R5A2 C2SY52 C2UB24 C3E0R0 J8HJE9 J8KAB7 J8LA42 J8LF71 J8MV84 J8RMD9 J8Y7I1 N1LFF1 Q81G85 R8HAP9 S3IU49
APC24667 NP_831105.1.86172 WP_000750893.1.100082 WP_000750893.1.10055 WP_000750893.1.100912 WP_000750893.1.101720 WP_000750893.1.10584 WP_000750893.1.11442 WP_000750893.1.1354 WP_000750893.1.13975 WP_000750893.1.14006 WP_000750893.1.14039 WP_000750893.1.14174 WP_000750893.1.14176 WP_000750893.1.17374 WP_000750893.1.18914 WP_000750893.1.19438 WP_000750893.1.20208 WP_000750893.1.20651 WP_000750893.1.22699 WP_000750893.1.23245 WP_000750893.1.23540 WP_000750893.1.23652 WP_000750893.1.25290 WP_000750893.1.25599 WP_000750893.1.26513 WP_000750893.1.26637 WP_000750893.1.28237 WP_000750893.1.32784 WP_000750893.1.32927 WP_000750893.1.33717 WP_000750893.1.34061 WP_000750893.1.36221 WP_000750893.1.38345 WP_000750893.1.3925 WP_000750893.1.39957 WP_000750893.1.40818 WP_000750893.1.41090 WP_000750893.1.41464 WP_000750893.1.41518 WP_000750893.1.41729 WP_000750893.1.4447 WP_000750893.1.44956 WP_000750893.1.45317 WP_000750893.1.47975 WP_000750893.1.51072 WP_000750893.1.54240 WP_000750893.1.54547 WP_000750893.1.54736 WP_000750893.1.55116 WP_000750893.1.56320 WP_000750893.1.58822 WP_000750893.1.59058 WP_000750893.1.59997 WP_000750893.1.60153 WP_000750893.1.61820 WP_000750893.1.61919 WP_000750893.1.6304 WP_000750893.1.63902 WP_000750893.1.64282 WP_000750893.1.64568 WP_000750893.1.65803 WP_000750893.1.67001 WP_000750893.1.67873 WP_000750893.1.67912 WP_000750893.1.6846 WP_000750893.1.68562 WP_000750893.1.69347 WP_000750893.1.70108 WP_000750893.1.71114 WP_000750893.1.72752 WP_000750893.1.73396 WP_000750893.1.73457 WP_000750893.1.73594 WP_000750893.1.73790 WP_000750893.1.7534 WP_000750893.1.75891 WP_000750893.1.7593 WP_000750893.1.75942 WP_000750893.1.76155 WP_000750893.1.76804 WP_000750893.1.76902 WP_000750893.1.77402 WP_000750893.1.80126 WP_000750893.1.80649 WP_000750893.1.81773 WP_000750893.1.84775 WP_000750893.1.85348 WP_000750893.1.85592 WP_000750893.1.86619 WP_000750893.1.86763 WP_000750893.1.88154 WP_000750893.1.88200 WP_000750893.1.89325 WP_000750893.1.90352 WP_000750893.1.90452 WP_000750893.1.91367 WP_000750893.1.93683 WP_000750893.1.93838 WP_000750893.1.9533 WP_000750893.1.95576 WP_000750893.1.96272 WP_000750893.1.96287 WP_000750893.1.96437 WP_000750893.1.9700 WP_000750893.1.97262 WP_000750893.1.97670 WP_000750893.1.97816 WP_000750893.1.97842 WP_000750893.1.98604 WP_000750893.1.99212 226900.BC1323 gi|30019474|ref|NP_831105.1| gi|296502002|ref|YP_003663702.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]