SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296504186|ref|YP_003665886.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296504186|ref|YP_003665886.1|
Domain Number 1 Region: 41-307
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.06e-52
Family Transferrin 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|296504186|ref|YP_003665886.1|
Sequence length 312
Comment phosphonates-binding protein [Bacillus thuringiensis BMB171]
Sequence
MLKKVFAMSTTVVLAAGLLSGCGTKESSASKNEDTKKGYVPKTLNVQFVPSQNADTLEAK
AKPLEKLLSDKLNIPVKVSISTNYNTIVEAMASKQVDVGFLPPTAYVLAHEKKAANVILQ
AQRFGVEDETGAPTKDLVDYYKSEFVVKKDSNINSVKDLKGKKIGYQDVTSSAGYVWPAA
VLLKEGIDPLKDVKPVTLKGHDQSLIALLNGDVDAAVVFQDARNIVKKDYPNIFEQTKIV
KFTEKIPNDTISVRSDLDEEWSKKLQDAFIEIGKNEEGHKIIKEVYSHEGYVKSDDSKFD
IVREYGKKVKTQ
Download sequence
Identical sequences A0A0G4CYP3 A0A0J6MUE8 A0A0T8DEL5 A0A1M6RFR2 A0A1Q9KHW6 A0A1Y0TPQ1 A0A229M3T2 A0A243DXK0 A0A243HQB7 A0A243KT06 A0A243L6K7 B7HCG5 J8F6L4 J8MCX1 J8MSM8 N1LPI0 R8H4C6
405532.BCB4264_A3795 WP_000915065.1.10055 WP_000915065.1.100912 WP_000915065.1.1354 WP_000915065.1.14006 WP_000915065.1.14174 WP_000915065.1.14176 WP_000915065.1.19438 WP_000915065.1.20208 WP_000915065.1.20651 WP_000915065.1.21055 WP_000915065.1.22699 WP_000915065.1.24680 WP_000915065.1.25290 WP_000915065.1.25599 WP_000915065.1.26637 WP_000915065.1.32927 WP_000915065.1.33201 WP_000915065.1.39957 WP_000915065.1.41464 WP_000915065.1.41518 WP_000915065.1.44956 WP_000915065.1.45317 WP_000915065.1.46326 WP_000915065.1.4964 WP_000915065.1.5025 WP_000915065.1.51072 WP_000915065.1.54240 WP_000915065.1.55116 WP_000915065.1.56320 WP_000915065.1.58822 WP_000915065.1.59058 WP_000915065.1.59997 WP_000915065.1.60153 WP_000915065.1.60334 WP_000915065.1.6304 WP_000915065.1.63902 WP_000915065.1.64282 WP_000915065.1.64568 WP_000915065.1.65803 WP_000915065.1.67001 WP_000915065.1.67873 WP_000915065.1.67912 WP_000915065.1.6846 WP_000915065.1.68562 WP_000915065.1.71114 WP_000915065.1.73396 WP_000915065.1.73594 WP_000915065.1.73790 WP_000915065.1.7593 WP_000915065.1.76086 WP_000915065.1.76155 WP_000915065.1.76804 WP_000915065.1.76902 WP_000915065.1.80126 WP_000915065.1.80649 WP_000915065.1.85592 WP_000915065.1.86619 WP_000915065.1.86637 WP_000915065.1.87768 WP_000915065.1.88154 WP_000915065.1.88200 WP_000915065.1.90352 WP_000915065.1.93683 WP_000915065.1.95576 WP_000915065.1.96287 WP_000915065.1.96437 WP_000915065.1.97262 WP_000915065.1.97842 WP_000915065.1.98604 gi|296504186|ref|YP_003665886.1| gi|218231821|ref|YP_002368499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]