SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296504508|ref|YP_003666208.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296504508|ref|YP_003666208.1|
Domain Number 1 Region: 42-407
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.25e-95
Family Phosphate binding protein-like 0.00000591
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296504508|ref|YP_003666208.1|
Sequence length 419
Comment glycerol-3-phosphate-binding protein [Bacillus thuringiensis BMB171]
Sequence
MKKALSLLTVSALSIGMLSACGPKDSGKKEESKAKKDYDLLVWEDDKKGVGLEPAVKSFE
EKYKVKVKVVEMQMTDQVKKLRLDGPAGTGPDVVTLPHDQIGNAVTEGLLSEVKADDAVK
SKFTNSSIEAQTYNGKLYGLPKAIETPVFIYNKKLMPKAPETMDELFNFSKEFTKDGKYG
FLALGDNFYFANAFMAGMGGYVFGEKDGKPNASDVGLNNSGAVQGAEYLQKWYKEKLFPK
GIIGESGGPAADGLFNEGKAASIMNGPWAFQAMEKNGIDYGVAPMPKLPNGQPMKTFVGV
KGWHVTSFSKQNDLATKFTEWVTNEENAKIRFEKTKEIPPVKSVMEDPIIKDNEAAKAVA
TQSENGIPMPNIPEMQEVWKPAGDALQLVVTDKEAPKAALDSAVKQIKGNIEANHNKKK
Download sequence
Identical sequences A0A023PAP5 A0A0D1R6V9 A0A0F6FKU7 A0A0G4CXM6 A0A0K0SCR3 A0A0T8M532 A0A135WV20 A0A150CIM0 A0A1B1SUI1 A0A1C9BXZ0 A0A1G1URX5 A0A1M6IZM8 A0A1Q9KH00 A0A1W2GGT5 A0A229MN43 A0A242ZHA6 A0A243D908 A0A243DRD1 A0A243HG09 A0A243J672 A0A243KQ28 A0A243KZP0 A0A243MC14 A0A2C9ZGC8 B5USG1 B7H903 C2N5N6 C2UIN9 G9Q2F8 J7Z0N6 J8ILL8 J8L767 J8MLZ2 J8N943 N1LW21 R8E0F3 R8E836 R8FDW2 R8G0R2 R8GCF5 R8GUG0 R8K3T7 R8LD71 R8PIR0 R8TG31
WP_000709923.1.100082 WP_000709923.1.10055 WP_000709923.1.100912 WP_000709923.1.101224 WP_000709923.1.10584 WP_000709923.1.10745 WP_000709923.1.10845 WP_000709923.1.1112 WP_000709923.1.13279 WP_000709923.1.1354 WP_000709923.1.13975 WP_000709923.1.14006 WP_000709923.1.14039 WP_000709923.1.14174 WP_000709923.1.14176 WP_000709923.1.18749 WP_000709923.1.18914 WP_000709923.1.19438 WP_000709923.1.19516 WP_000709923.1.20208 WP_000709923.1.20651 WP_000709923.1.21055 WP_000709923.1.2206 WP_000709923.1.22152 WP_000709923.1.2251 WP_000709923.1.22699 WP_000709923.1.23297 WP_000709923.1.23540 WP_000709923.1.23652 WP_000709923.1.24680 WP_000709923.1.24795 WP_000709923.1.25290 WP_000709923.1.25599 WP_000709923.1.26513 WP_000709923.1.26826 WP_000709923.1.26872 WP_000709923.1.26965 WP_000709923.1.27106 WP_000709923.1.27931 WP_000709923.1.28237 WP_000709923.1.29836 WP_000709923.1.29993 WP_000709923.1.31221 WP_000709923.1.3180 WP_000709923.1.32784 WP_000709923.1.32927 WP_000709923.1.33201 WP_000709923.1.33717 WP_000709923.1.34175 WP_000709923.1.34587 WP_000709923.1.35694 WP_000709923.1.36221 WP_000709923.1.37239 WP_000709923.1.3798 WP_000709923.1.38345 WP_000709923.1.38427 WP_000709923.1.38591 WP_000709923.1.39411 WP_000709923.1.39957 WP_000709923.1.40430 WP_000709923.1.41090 WP_000709923.1.41464 WP_000709923.1.41518 WP_000709923.1.4185 WP_000709923.1.41879 WP_000709923.1.42167 WP_000709923.1.42218 WP_000709923.1.42485 WP_000709923.1.43442 WP_000709923.1.43767 WP_000709923.1.44428 WP_000709923.1.44497 WP_000709923.1.44956 WP_000709923.1.45317 WP_000709923.1.45720 WP_000709923.1.46326 WP_000709923.1.47000 WP_000709923.1.47437 WP_000709923.1.49455 WP_000709923.1.4964 WP_000709923.1.49702 WP_000709923.1.5025 WP_000709923.1.50694 WP_000709923.1.51047 WP_000709923.1.51072 WP_000709923.1.51681 WP_000709923.1.54142 WP_000709923.1.54240 WP_000709923.1.54777 WP_000709923.1.55077 WP_000709923.1.55116 WP_000709923.1.5543 WP_000709923.1.58632 WP_000709923.1.59058 WP_000709923.1.59997 WP_000709923.1.60153 WP_000709923.1.60255 WP_000709923.1.60334 WP_000709923.1.61243 WP_000709923.1.6304 WP_000709923.1.63743 WP_000709923.1.63789 WP_000709923.1.63902 WP_000709923.1.64282 WP_000709923.1.6475 WP_000709923.1.64764 WP_000709923.1.66999 WP_000709923.1.67001 WP_000709923.1.674 WP_000709923.1.6743 WP_000709923.1.67912 WP_000709923.1.68007 WP_000709923.1.6816 WP_000709923.1.68346 WP_000709923.1.6846 WP_000709923.1.68562 WP_000709923.1.69501 WP_000709923.1.70108 WP_000709923.1.70181 WP_000709923.1.71114 WP_000709923.1.71242 WP_000709923.1.72484 WP_000709923.1.73396 WP_000709923.1.73457 WP_000709923.1.73594 WP_000709923.1.74302 WP_000709923.1.74372 WP_000709923.1.74832 WP_000709923.1.74857 WP_000709923.1.74863 WP_000709923.1.74976 WP_000709923.1.7534 WP_000709923.1.75866 WP_000709923.1.75891 WP_000709923.1.76086 WP_000709923.1.76804 WP_000709923.1.76883 WP_000709923.1.77386 WP_000709923.1.77567 WP_000709923.1.79549 WP_000709923.1.80126 WP_000709923.1.81000 WP_000709923.1.81570 WP_000709923.1.81773 WP_000709923.1.83694 WP_000709923.1.83977 WP_000709923.1.84614 WP_000709923.1.85348 WP_000709923.1.85592 WP_000709923.1.85667 WP_000709923.1.85928 WP_000709923.1.86374 WP_000709923.1.86637 WP_000709923.1.869 WP_000709923.1.87013 WP_000709923.1.87725 WP_000709923.1.87777 WP_000709923.1.87947 WP_000709923.1.88154 WP_000709923.1.88200 WP_000709923.1.89009 WP_000709923.1.90352 WP_000709923.1.90466 WP_000709923.1.90665 WP_000709923.1.93683 WP_000709923.1.94308 WP_000709923.1.94914 WP_000709923.1.95576 WP_000709923.1.96287 WP_000709923.1.96437 WP_000709923.1.97082 WP_000709923.1.97262 WP_000709923.1.97670 WP_000709923.1.97993 WP_000709923.1.9860 WP_000709923.1.98604 WP_000709923.1.99212 WP_000709923.1.99636 405532.BCB4264_A4119 gi|449090956|ref|YP_007423397.1| gi|218234367|ref|YP_002368816.1| gi|296504508|ref|YP_003666208.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]