SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296504644|ref|YP_003666344.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296504644|ref|YP_003666344.1|
Domain Number 1 Region: 1-257
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.18e-66
Family Phosphate binding protein-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296504644|ref|YP_003666344.1|
Sequence length 259
Comment arginine-binding protein [Bacillus thuringiensis BMB171]
Sequence
MKKLVSISFALILIVSIFSACSNGESKETKGNKKVLVMGTSADYKPYEYVDASKSDEIIG
FDVDVAKYIGKELGYEVKVKDMDFGGLLASLSSGKVDFVMAGMTPTAERKNNVDFTDIYF
VAKNMVVSKKDSNIKSVEDLKGKKVGVQTGSIQEEKAAEFKKQVDFQVEGRDRIPEIVQE
IKAGRFDAAIIEDTVAKNYLEKMKDLQGVEIKEAPEEVGAAIALPKNSDKTAEFNKVIKK
MQENGEMDKLVKKWFGSGK
Download sequence
Identical sequences A0A0D1QVV7 A0A0T8GN28 A0A1M6IRI7 A0A1S9YVF3 A0A229MMV5 A0A243DR03 C2UIG3 C3E896 J8L2M8 J8N4U5 R8GU45
gi|296504644|ref|YP_003666344.1| WP_000737675.1.14176 WP_000737675.1.18914 WP_000737675.1.19438 WP_000737675.1.20208 WP_000737675.1.23540 WP_000737675.1.23652 WP_000737675.1.24680 WP_000737675.1.25599 WP_000737675.1.28237 WP_000737675.1.32927 WP_000737675.1.33201 WP_000737675.1.36221 WP_000737675.1.41464 WP_000737675.1.41518 WP_000737675.1.44956 WP_000737675.1.55116 WP_000737675.1.59997 WP_000737675.1.60153 WP_000737675.1.6304 WP_000737675.1.67001 WP_000737675.1.67912 WP_000737675.1.6846 WP_000737675.1.68562 WP_000737675.1.71114 WP_000737675.1.76155 WP_000737675.1.85348 WP_000737675.1.85592 WP_000737675.1.86637 WP_000737675.1.88200 WP_000737675.1.96437 WP_000737675.1.98604 WP_000737675.1.99212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]