SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296505248|ref|YP_003666948.1| from Bacillus thuringiensis BMB171

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296505248|ref|YP_003666948.1|
Domain Number 1 Region: 32-259
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.19e-34
Family Phosphate binding protein-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296505248|ref|YP_003666948.1|
Sequence length 335
Comment ABC transporter substrate-binding protein [Bacillus thuringiensis BMB171]
Sequence
MKKLIAIFCIMLLAVFTFAACSSKKEGTKEQTQNIRVGEVTHSLFYAPLYVGIEKGFFKD
EGLNIDLQTTAGGDKTMTALLSGGIDIALVGSETSIYVHQQGAKDPVINFAQLTQTDGTF
LVSRKKLDSFNWNDVKGVTFLGQRKGGMPQMVGEYVLKKNGIDPRKDTNLIQNIEFANIA
NAFASGTGEFVQLFEPTASIFEKEGKGYIVASFGNESGTVPYTTFMAKESFLKKDKAAAE
KFTRALYKAQQWVDTHSPEEIADAVSPLFKDTSKDITVKVIERYKKQHSYATNPLLDAEE
WKQLQTIMKDAGELQKEVPYEALVNTKIAESVIKK
Download sequence
Identical sequences A0A1M6MY95 A0A1Y5ZDZ9
gi|296505248|ref|YP_003666948.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]