SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|560159225|ref|YP_008851940.1| from Shigella dysenteriae 1617

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|560159225|ref|YP_008851940.1|
Domain Number 1 Region: 27-145
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.34e-29
Family C-terminal domain of adrenodoxin reductase-like 0.0053
Further Details:      
 
Domain Number 2 Region: 29-48,143-212
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000155
Family FAD/NAD-linked reductases, N-terminal and central domains 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|560159225|ref|YP_008851940.1|
Sequence length 216
Comment Glutamate synthase [nadph] small chain [Shigella dysenteriae 1617]
Sequence
MYAALPFLIANTKQLMGFGETREEPFVSMEGKRVVVLGGGDTAMDCVRTSVRQGAKHVTC
AYRRDEENMPGSRREVKNAREEGVEFKFNVQPLGIKVNGNGKVSGVKMVRTEMGEPDAKG
RRRAEIVAGSEHIVPADAVIMAFGFRPHSMEWLAKHSVELDSQGRIIAPEGSDNAFQTSN
PKIFAGGDIVRGSDLVVTAIAEGHKAADGIMNWLEV
Download sequence
Identical sequences A0A0A6ZZ03
gi|560159225|ref|YP_008851940.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]