SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296110648|ref|YP_003621029.1| from Leuconostoc kimchii IMSNU 11154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296110648|ref|YP_003621029.1|
Domain Number 1 Region: 5-82,174-351
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.83e-57
Family Bacterial dinuclear zinc exopeptidases 0.0000405
Further Details:      
 
Domain Number 2 Region: 72-182
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 9.62e-23
Family Aminopeptidase/glucanase lid domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296110648|ref|YP_003621029.1|
Sequence length 358
Comment glutamyl-aminopeptidase [Leuconostoc kimchii IMSNU 11154]
Sequence
MNDKTWSRIKKYTELQGTSGQEHMLRQTFRAELQPLVEDIQQDGLGGIFGVKTHSNPQAP
RVMFAAHMDEVGFIVTQILASGAIKVAAVGGWNVTVISSQRFTLFTSKGNYPVVSSSVSP
HLLRGGGSSPTLPTVDDILFDAGFVDGQEAIAFGVRPGDFIVPDVKTVKTANQKRVISKS
WDNRFGMVTVLETLEALKDVQTPNTLIMGADVQEEVGLRGAHGAVNLMKPDIFFAIDSSA
ADDLVDATGHQGVLDQGTLLRVFDPTVILPLRLKEFLLSTAEDNHIPYQYFVSKGGTDAA
AAQSELTGIPSVALGVASRYIHTHQTVWSIADFEAATAFVIAIAKNLDESNLKTILGD
Download sequence
Identical sequences D5T1B1
WP_013102658.1.100683 WP_013102658.1.16019 gi|339490260|ref|YP_004704765.1| gi|296110648|ref|YP_003621029.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]