SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|296111827|ref|YP_003622209.1| from Leuconostoc kimchii IMSNU 11154

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296111827|ref|YP_003622209.1|
Domain Number 1 Region: 268-362
Classification Level Classification E-value
Superfamily PTS-regulatory domain, PRD 0.0000000000000732
Family PTS-regulatory domain, PRD 0.0039
Further Details:      
 
Domain Number 2 Region: 151-260
Classification Level Classification E-value
Superfamily PTS-regulatory domain, PRD 0.0000000000327
Family PTS-regulatory domain, PRD 0.02
Further Details:      
 
Domain Number 3 Region: 366-447
Classification Level Classification E-value
Superfamily PTS system IIB component-like 0.0000000012
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.012
Further Details:      
 
Weak hits

Sequence:  gi|296111827|ref|YP_003622209.1|
Domain Number - Region: 8-51
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000447
Family CodY HTH domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296111827|ref|YP_003622209.1|
Sequence length 454
Comment hypothetical protein LKI_08505 [Leuconostoc kimchii IMSNU 11154]
Sequence
MFLGQQVGFVDAKKIALTFKVSTKTVYRTINKLNSSEIIIESQRGRGYKLIEDLKLVTDT
KADVQRQIDMSVSLLTHFPNHMNRLKFIDKFYISDSTLTRDLTRIGEKLKKFNIQLNRSD
GEVTVIATEVQVRKALNYFFLENTRTKNVLDNISEIFPNISVENQTFISSQMMLIEQKLN
VQILEPYTINIFSHLYILLERVRQHRYEITESHVVQQHYDTMLTKVARQIILNISQFSHE
EIPDQEINNLLIYLVGLRYDKQLDDSNNDEAYQLVDFLIRNLSLTDRYVNFETLKKGLLG
HVRPMIHRIESGIAVVNPLLSDIKFSYREVFGQIRLVLDRSQYTISDDEIGFLTLYVVRA
LEEVTDHKRVLLMCSTGVGTAQLLQTKVRHAFPNFEIIDIVSSKAYQMNMNNYQNIDLVI
STVNITYQPISPVIQVSALFNEGDKRRIEELIYG
Download sequence
Identical sequences D5T5B0
WP_013103829.1.100683 gi|296111827|ref|YP_003622209.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]