SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|304315902|ref|YP_003851047.1| from Thermoanaerobacterium thermosaccharolyticum DSM 571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304315902|ref|YP_003851047.1|
Domain Number 1 Region: 5-276
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.28e-90
Family G proteins 0.00000145
Further Details:      
 
Domain Number 2 Region: 465-581
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.07e-44
Family Translational machinery components 0.0000183
Further Details:      
 
Domain Number 3 Region: 259-387
Classification Level Classification E-value
Superfamily Translation proteins 5.44e-29
Family Elongation factors 0.00053
Further Details:      
 
Domain Number 4 Region: 582-672
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.29e-27
Family EF-G/eEF-2 domains III and V 0.0000923
Further Details:      
 
Domain Number 5 Region: 387-465
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.2e-20
Family EF-G/eEF-2 domains III and V 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|304315902|ref|YP_003851047.1|
Sequence length 678
Comment translation elongation factor G [Thermoanaerobacterium thermosaccharolyticum DSM 571]
Sequence
MKDYKTQQIRNVGLVSHGGAGKTTLTEALLYNAKAIDRIGRVEDGTTVSDYDPEEISRQF
SISTSVIPIEWKDYKLNVLDTPGYFDFFGEVISGLKAADSAVLVVCAASGVEVGTEKSFH
ILEEENLPTVIFINKMDRENADYYKTLNQLRDKFGNKVVPMTLPIGSEHSFTGYVDLITN
KAYVYNQKGIEEADVPKDMEENAQKFREELIEDIAENDEALLEKFFAGEELSKDELLHGL
KEGVKSRDIFPVICGSSLKNIGIDVLLNIMTDVLPSPDEVNKFGAVSDVNKPYSAFVFKT
IADPFVGKLSIFRVISGFITSDSTVFNGTKKANEKIGQLYILRGKKQMPVSKLVAGDIGA
CAKLQFTMTGDTLCDPANQVEFGPISFPEPTLALAIEPKAKGDEDKISSGLQRLQEEDQT
FKVEKNVETGQVIVYGMGEQHIEVLSKKLQSKFGVECVLTEPIIPYRETIKGKSKVEGKH
KKQTGGHGQYGHVWIEFEPYKEGEFKFEDKIFGGAVPKQYIPAVEKGLRECIKEGVLARY
PVVNIKATLLDGSYHPVDSSEMAFKVAASIAFKKGMEEANPVLLEPIMHVEVTVPEEYMG
DVIGDLNKRRGRILGMESEGEMEVVTAEVPQAEMAKYATDLRSLTHARGEFKMSFARYEE
APSVVAEKVIEARKKVQV
Download sequence
Identical sequences D9TRE3
gi|304315902|ref|YP_003851047.1| WP_013296939.1.54986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]