SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|304316415|ref|YP_003851560.1| from Thermoanaerobacterium thermosaccharolyticum DSM 571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304316415|ref|YP_003851560.1|
Domain Number 1 Region: 89-199
Classification Level Classification E-value
Superfamily AF1862-like 4.58e-34
Family Cas Cmr5-like 0.00058
Further Details:      
 
Weak hits

Sequence:  gi|304316415|ref|YP_003851560.1|
Domain Number - Region: 7-37
Classification Level Classification E-value
Superfamily AF1862-like 0.00549
Family Cas Cmr5-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|304316415|ref|YP_003851560.1|
Sequence length 200
Comment CRISPR-associated protein, Cmr5 family [Thermoanaerobacterium thermosaccharolyticum DSM 571]
Sequence
MSEQTMINKLEKGRAEFAYNCVSDAKKFRSNNGNVEKVLNEFLETIRNNIGKNADVDEKQ
KLLERFDQIFKEPDKYIVKENFANLEDDIKKALEKYSKFLENYRSYARKIPTMILTNGLG
QTVAFVSSKSEKETAYKLLYTQITEYIKSSCTSRITMPQEKNDLVEWVISCNSTEYRYIT
SEVLAFLNWLRRLAEGLIEK
Download sequence
Identical sequences D9TMI8
gi|304316415|ref|YP_003851560.1| WP_013297445.1.54986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]