SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|304316497|ref|YP_003851642.1| from Thermoanaerobacterium thermosaccharolyticum DSM 571

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|304316497|ref|YP_003851642.1|
Domain Number - Region: 4-89
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000233
Family N-acetyl transferase, NAT 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|304316497|ref|YP_003851642.1|
Sequence length 156
Comment hypothetical protein Tthe_1032 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
Sequence
MKPEKILLRDMEKRDKRTFSMWLKDVDVVKFLIDMFKVSRMSENVLNIPFGKNRKIFILQ
TNDGDNIGFCGLYNINWQLKRCSLYVYIDDCENVSDDVISDAMNSIVKSISLLKKFKILE
VHAKADILKKYMNNMSDAKKCNNEYVFEIGLNGKIV
Download sequence
Identical sequences A0A231VNV0 D9TN35
WP_013297526.1.54986 WP_013297526.1.57021 WP_013297526.1.88619 gi|304316497|ref|YP_003851642.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]