SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|304316820|ref|YP_003851965.1| from Thermoanaerobacterium thermosaccharolyticum DSM 571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304316820|ref|YP_003851965.1|
Domain Number 1 Region: 6-109
Classification Level Classification E-value
Superfamily YheA/YmcA-like 0.0000000000119
Family YmcA-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|304316820|ref|YP_003851965.1|
Sequence length 122
Comment hypothetical protein Tthe_1367 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
Sequence
MSRCDKDVIIEKAIELGKLLANSDILNDLREAEIAFLNDKEAQFLLEDIKKLKKNGDKKE
VGNLRLKLLKLDSYRRLLEAQETSKKLIEEIHGILNYYINGTLPKCDGNSCANCSRRCMS
NE
Download sequence
Identical sequences D9TTB5
gi|304316820|ref|YP_003851965.1| WP_013297848.1.54986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]