SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|304317819|ref|YP_003852964.1| from Thermoanaerobacterium thermosaccharolyticum DSM 571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|304317819|ref|YP_003852964.1|
Domain Number 1 Region: 168-331
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.85e-19
Family FemXAB nonribosomal peptidyltransferases 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|304317819|ref|YP_003852964.1|
Sequence length 370
Comment cellulose biosynthesis protein [Thermoanaerobacterium thermosaccharolyticum DSM 571]
Sequence
MDEGKILDIEIKIISDVKTLLSIKDIWHELEDNSKMYPFNTFEWVVNWWKYFGSGKKLWV
LLVVDDYGPIGIAPFMITFGEMGLPVRRIKFIGSNNSDYLDFVVRHGCEDIFYRSLIKYL
ETVIDQFTVLDLEHLPEDSGIYPYIMGSGLYYDYDVQDICPYIELPSTWDEYLDSLDGKF
RRNIKYEIKRYFSKHDGNFMCVTDENEIDDSMDRLIEMHQARWRKRHMPGAFYTKRIRNF
HKDVAFDFLERGILSLFELRDKNKTVASLLSYHIGGKRYYYISGYDLNYSRLSVGAVTLG
LSIKRSIEVGDEVYDFLRGDEKYKEDWTKHKKRNMRLVASYPSIAGRFYLYYIIAENKII
NKIKDRFSHD
Download sequence
Identical sequences A0A231VGK8 D9TSM5
WP_013298837.1.54986 WP_013298837.1.57021 WP_013298837.1.88619 gi|304317819|ref|YP_003852964.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]