SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297569407|ref|YP_003690751.1| from Desulfurivibrio alkaliphilus AHT2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297569407|ref|YP_003690751.1|
Domain Number 1 Region: 83-175
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.7e-31
Family Ribosomal protein L6 0.000092
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.26e-24
Family Ribosomal protein L6 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297569407|ref|YP_003690751.1|
Sequence length 178
Comment 50S ribosomal protein L6 [Desulfurivibrio alkaliphilus AHT2]
Sequence
MSRIGREPITVPDKVKVDIKGSQVTVTGPKGSLDRQVRPEIALEQEDGRVMVKAKDSSQR
TIAFTGLTRTLINNMVIGVEKGFEKKLVVEGVGYRVEVKGDALNLNVGYSNPVHFPLPEG
VSAAVEKNTLTLQAMDKELLGETAARIRAVRKPEPYKGKGIRYEDERIVRKAGKTKAK
Download sequence
Identical sequences D6Z3K7
gi|297569407|ref|YP_003690751.1| WP_013163660.1.52415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]