SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297569456|ref|YP_003690800.1| from Desulfurivibrio alkaliphilus AHT2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297569456|ref|YP_003690800.1|
Domain Number 1 Region: 57-183
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.02e-28
Family Penicillin binding protein dimerisation domain 0.0054
Further Details:      
 
Domain Number 2 Region: 167-449
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.02e-21
Family beta-Lactamase/D-ala carboxypeptidase 0.012
Further Details:      
 
Domain Number 3 Region: 599-643
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000406
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297569456|ref|YP_003690800.1|
Sequence length 663
Comment Penicillin-binding protein dimerization domain protein [Desulfurivibrio alkaliphilus AHT2]
Sequence
MRRTMSAKQRGRKMLFFTLLPLLFGLTLWGVFSLSEADEARLAPGYQKGTLVESSSLRRN
NIYDRNFETLAVSFRLSSLYARPLEVNDPETTAAEVARLLDLDRQHLLDSLRSERSFVWL
SRQVKKEVADEVLGRGLPGIYAMPSSHRYYPHHDGAAHVVGFVKDEQGLAGIELSYDNIL
RGGISDIRLAAAGVPDRVTAGGGVHLVSTLDLALQRELEQRMQRVLRTADGSAAAALIMN
VNTGEVLAMASLPGYDPNRFWAAGSEQRLNRAVMPQVHLGALGELFQRAAGETGGLAPAY
HTNDGELPAGGEAWWYPLAPDVYASSGFGGSGRATGALAEDFLQLMGLCQASNLDLLEGR
SLGPIMQVEELAADECRQLLMDRRAVVNGVSLLAAFSRLVNQGQPVEPHLIRGFWDGADF
WPRQSAITAAAMPAGFNRQMLQELATTAGNQGQVAIYESLVVEARSSAEKLEIAMADNAS
LLSGQGLEHQEQAGAAAVERAAAPQRYQAVMLGMAPIEKPELAALVFVDRARLDLALPSP
LAGVVRDLDQWVGRLEQAASPPAPAAILARKEALYHDWLGKQEAGDLQVHAATRRAPERM
PDVTGLSLRKALQVLQPSGLRFQVRGSGRVVKQEPPPGTPLREVDEGVLELRVPGGEMMA
AGS
Download sequence
Identical sequences D6Z3Q6
WP_013163708.1.52415 gi|297569456|ref|YP_003690800.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]