SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EPrPI00000016419 from Pythium irregulare DAOM BR486 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPI00000016419
Domain Number 1 Region: 83-191
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 2.62e-29
Family Frataxin-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) EPrPI00000016419
Sequence length 193
Comment pep:novel supercontig:GCA_000387425.2:pir_scaffold_154:32563:33343:-1 gene:maker-pir_contig_154-fgenesh-gene-0.14 transcript:EPrPIT00000016419 description:"Frataxin."
Sequence
MLAPMRRAARRALQTSMATTTKSQRSATTAVSPFTAAQVLLAPTSALRSCLLSQRAFSTG
NDASSSSDNGNGNGNGNGAAPLDAVEENRFLELADTALHDIMSWLDGVEEMLEESDISLS
QGVLKIDLGEDGTWVINRQIPNRQLWWSSPISGPRRYEYDAETGTWLNTRDGTELMELLR
NEIFEASGIEIYE
Download sequence
Identical sequences EPrPI00000016419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]