SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPI00000024405 from Pythium irregulare DAOM BR486 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPI00000024405
Domain Number 1 Region: 10-226
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.99e-30
Family Nitrogenase iron protein-like 0.019
Further Details:      
 
Domain Number 2 Region: 271-353
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.0000126
Family HPr kinase/phoshatase HprK N-terminal domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPI00000024405
Sequence length 381
Comment pep:novel supercontig:GCA_000387425.2:pir_scaffold_1735:71:1468:-1 gene:maker-pir_contig_1735-fgenesh-gene-0.2 transcript:EPrPIT00000024405 description:"Cobyrinic acid a,c-diamide synthase family protein."
Sequence
MPTRSAKKAAVYVAATRQHVGKTSTCLGLLQGLTSRIDKIGFLKPVGQQSVLVNDGTLRV
DKDVAVAKEIFHLNSCHYEDMSPVVIPPGYTRNFLDGKITLGSQLDKIRQSFEKITAAND
YTIVEGTGHTGVGSIVDVNNARVAAELGIDMVLIANGGIGSAFDDLALNYALCKDYGVKV
RGVILNKVRPDKMEMVSEYFPKALKQWGMPLIGVVPNLPSLANQSMLDFEGLFKTRLLSA
PERRFQQYTKTSLVTSGLRRFLVKLSSNKFNDTLFVTHASRNDIILGFLSHSQNYELKTG
EPYNGGLILTGEPPVDQPQDYIMEIIQRSNAPVLYAPVTTFEAMEKITRFTAKFNPTDRQ
KVTACGEHYAKYINFDIILDR
Download sequence
Identical sequences EPrPI00000024405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]