SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPI00000025505 from Pythium irregulare DAOM BR486 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPI00000025505
Domain Number 1 Region: 380-701
Classification Level Classification E-value
Superfamily Isocitrate/Isopropylmalate dehydrogenase-like 1.07e-84
Family Phosphotransacetylase 0.000000562
Further Details:      
 
Domain Number 2 Region: 3-215
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.9e-16
Family Nitrogenase iron protein-like 0.049
Further Details:      
 
Domain Number 3 Region: 206-338
Classification Level Classification E-value
Superfamily HprK N-terminal domain-like 0.00000000000000628
Family DRTGG domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPI00000025505
Sequence length 719
Comment pep:novel supercontig:GCA_000387425.2:pir_scaffold_2716:30:2189:1 gene:maker-pir_contig_2716-snap-gene-0.1 transcript:EPrPIT00000025505 description:"Phosphate acetyltransferase."
Sequence
KTSSVLLGLAHTLEQKFSSVGYFRPIAPSPTSAVQDHHMDLMHSELELPQKKNEIYGVTS
ERALECWLSGKSDDLVEEILNAFENCKKDHDFMLIEGSPITEHESAMSWKINVDIARAIG
SPVLLLTDLAAVSLTNGDLVQEIVSRTVLGKEQVEAAGLNYFGTIANRVRAKDPQSTRKK
LREIMAEKDLPFLGFLPHDELIASKRLNEVAYKLGAKQLFGSTEISNNVIVSDAVVATSH
LRDLFAHLKKYKDGVLVITSADRSDILLGLLASRIPGVLPNVAGIVLTNGDYPHSNTHEI
LQGVAELDKTGLSIPIFVVPHDTYSTSTAVSRVSTDILPTSVRKIGQCKTIFDEYIEKEM
LIGELDEGVVLHRSPKHFKHFVLNKARSVQRHIVLTEGEDIRILQAADEILRLRLAKLTI
LGDPEEIRLHAKTLNLDLSGANIVKTLDSDLMDKYAEALYEKRKHKGMTMEVARDTVAEA
TYFGTMMVEMGDADGMVSGVCHTTANTIRPALQLIKTSPDRPLVSSVFFMCLEDGVRIYG
DCAVNTNPTAEELAQIAVTSAESAEAFGMIPRVALLSYATGDSNTGPIIDKVREATKIAQ
GMRPDLDIYGPIQYDAAVDEAIAKQKLKADSSGARVGGRANVLIFPDLNTGNNTYKAVQQ
STQCIAMGPMLQGLRKPVNDLSRGATVKDIVTTVAITSIQAEQMIVKRNAAAEAAEKKN
Download sequence
Identical sequences EPrPI00000025505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]