SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPI00000014339 from Pythium irregulare DAOM BR486 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPI00000014339
Domain Number 1 Region: 1949-2239
Classification Level Classification E-value
Superfamily BEACH domain 1.57e-119
Family BEACH domain 0.00000000933
Further Details:      
 
Domain Number 2 Region: 2394-2667
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.05e-23
Family WD40-repeat 0.0045
Further Details:      
 
Domain Number 3 Region: 1825-1924
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000738
Family PreBEACH PH-like domain 0.0093
Further Details:      
 
Domain Number 4 Region: 191-370
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000257
Family Clostridium neurotoxins, the second last domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) EPrPI00000014339
Sequence length 2674
Comment pep:novel supercontig:GCA_000387425.2:pir_scaffold_41:3581:11768:1 gene:maker-pir_contig_41-snap-gene-0.29 transcript:EPrPIT00000014339 description:"LPS-responsive vesicle trafficking, beach and anchor containing isoform 1."
Sequence
MAMEDDVRNMLLDVETAQQQTLGAAANEPELIADLKDPVLFLLDLLSQVDAQMEVLEVLR
RVFLPCLAFCYDPRVFLDVPKKKEKQCDTAADEATVPLSSPSPSPPRGKKGNVVLKAFLD
ALHVLTTKFEVRIEVVQGVVTLIKEMCVQSVTSIDVVMLFDFLRVGKPPARQLLLEMQTK
LIEMEMTPRAIFTMKGPHGGIIAPSSQMLFSKKGYSFSCGVLLDVNSTVVSLYSFRGNSG
QGISAMLDGNTLVMKTHLQQGNFSQVVIPFTDGRRQMETAWTHLCIVHAKKMVFKDKLSV
YVNGKLVQTGSLVYPDPLCMVGGHNCIGIMPTLPGLQGKIWSPTLFGSVLTESEIDKLHW
LTHWKNDLSSAAAENTGLTDKSKFSFSYDARSCDAENCICYDVSGNDCHGWIEPGTNAFV
TQSFVQALDSIGGCACFLLLLLDQIPEMADFHPKHEFSMEEISEVFGFVAAGLKSSIACR
SHFIRLDGVKVLVFVLQSISPTYLSVELLDGVTKILEALVEFVPQHVAIEYINLLLFLNT
SWYLSPFNTQGKLLAEVLPRYLQTIQERGMSSGKQQGNSHSSSSNHLSPSRGVDATTDSE
PKQEVNVRFFCNLLVQVYSPRSREEVRVEPMNDIQLEFLRKLIIHNLIDRLLFPVVPDAS
IDQWRQLVVYVQQRSFAMGSSDSEGEGAKDSVELKEIVRYLTQILTSDTQATSSQTTSAR
RMMTSKISKLSEGTLRLWWKPMMSANETVQFEALKLFEAYTLDKIVLKTRDMLMLYSSMQ
AHPITLPIAEVLLDIVIGKKRFGYFGNDTGAPGFSVSAEGGSRSVNIARQDFVPLILLGL
LQHAEFDVQAYILLEIKGQVSSPMSGESLKEAIRSWPPWLCRLRAVSAGAADGITSSELE
HRAAESEVDPWLQEKLIVLNDENSPVSSRLEAIQEISQAGDARGCLCVLRIFQNTEQPAS
IAKAMTALIRQQLPEWCHVLAHKTANQMIVDIVVYSVLYVRSGWMHFLEFYFYHFRQPAD
LVALSSSICEKVLAKVWQKDISSFVEAEILWENICQVAAILAQCQIVTQLPNFEKDAALS
PRQERDLMHRAFELWLVVLPHLHQVNWSDMKDHLALHANYGEDVVAEKKEIFCNLVAACA
RSRLLALHSGIEYIRLSQQVKECSTSQVDGLRKLLECLRVIRPSHALEQRGDEAHAAAKT
ITRSSRSNSASFQLTPNSAGSKAAVGPILADSTMFFGSNESDSSADHQEQKELIHLYILE
TCFALLRDELAASNSFSTSYSIVDIMVATANSALLLQDDSVMPELSKTLQIISSTDLTFF
HELSQLEDFFTLWQLHREIHKTCCDLDSFQQQVDALHAPFLRRWRNHVNQSTTDFNPYLT
QKHASAQAEILSQEIQSCEKLWEQIAADTAAAMQGTENDDRDESCLPPLKDGVEKFASSV
HKLICHTSNELLSLPDESTAVAAALDPTPNIERKRVNDGFLYKVASKENSLRMHLRLKKV
RENYRLRNLSCEYAGSSFQNTESRGSGKFARRLFRGSAPNASEMEQSWRSDAGSDYSDFL
ADAHMRAAIIRSCSNVDMRNSEYEVHSDEDDADDDDVQFYDPHDEDENVSEEVAEVLQFY
SSNDDAEDGTGTNELDSSAELNSSQPQSSSATYEPMPIHPLALSSPPPPASSNVSSVPSS
TSSLSAFSIGASVLSVVGGVAGMVQKAAKDAKDAVEFGVDSLYTAKDALTDEAQSLMDEV
STYMEGNDFDGAYISGSAASGSPHTKSSPLAAKASRDKNSGSPVLFPPSPVVDTQLKSKG
KDAIQRQRLKGLARSGSSSSKQDVVVSAKLVRHMHIVDGTLALSDSSLLFVPERVIDEHD
SVLVEKKKGVTIEKSWSFLFKRRRWKLDDIASLNRRRYLLKSTALEIFVHSTRRNYFFNL
SQEDLSWFHEALMFRRPLLLKRDPAMRRLRHPSSIFRNSNMSTRWVNHEISTFEYLMWLN
TIAGRTYNDLTQYPIFPWVIADYESPVLDLSQQSTFRDLAKPIGALDPARLKFYLDRYNA
FEDSDIPKFMYGTHYSNIGAVLYYLIRLEPYTSYALSVQGGKFDHADRLFHSVAETWRNC
LTDFTDVKELTPEWFYLPDFLVNCNGLDLGTKQNGVDLDNVILPPWARSPEDFVMKNFVA
LESEYVSANIHHWIDLIFGSNQRGLAAVAANNVFFYLTYEGLVDIDSITDPVTKSSMRAQ
IAHFGQTPSQVLRDPHPARNFLVMPRFSGLFTEGNGSNMITKLDYEHGEDVPTTNPLVPN
FIPTLVTLPHEHPIVFVQMVYGTYMLLCVDSSGMLSSQRFGGKLAKVHHSPFLNDLSASA
TKASGVFKSSGSSSSGAGGITVGSPPTSSSFLEPLAAEYIEIQDRKCRKLTSEKQLLAHS
GQGLANTVTFLNGGSVFCTVGHHDFSARFYSASDGTLLYRLLQHNSVVTCLATNKVGSIL
GLGSADGTISVWKVANINSTLLDSIKIFRGSKSNKPVHANDYAADQVLLGHNATIKCVAI
SEELGVCISGSASNECLAHNLDDGSILRQFDVSGQLSPGVISVVLSPVGHVLVQSMGTGA
SILYSFHFNGTLMAKVSLGDRPMMSIDVCARYSKVVVSNSERAIVFAAHTLEDKEMVLER
EKVGEIVSQALSPDETHLVFGVASGKLVSIPLLP
Download sequence
Identical sequences EPrPI00000014339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]