SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPI00000022057 from Pythium irregulare DAOM BR486 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPI00000022057
Domain Number 1 Region: 2083-2379
Classification Level Classification E-value
Superfamily BEACH domain 1.15e-118
Family BEACH domain 0.0000000147
Further Details:      
 
Domain Number 2 Region: 2553-2634,2668-2887
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.11e-22
Family WD40-repeat 0.012
Further Details:      
 
Domain Number 3 Region: 1876-1929,2004-2056
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-19
Family PreBEACH PH-like domain 0.02
Further Details:      
 
Domain Number 4 Region: 210-275
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000246
Family Clostridium neurotoxins, the second last domain 0.043
Further Details:      
 
Weak hits

Sequence:  EPrPI00000022057
Domain Number - Region: 142-188
Classification Level Classification E-value
Superfamily RING/U-box 0.000326
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number - Region: 598-666,888-948,1037-1075,1329-1349,1394-1436
Classification Level Classification E-value
Superfamily ARM repeat 0.0335
Family Armadillo repeat 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPI00000022057
Sequence length 2896
Comment pep:novel supercontig:GCA_000387425.2:pir_scaffold_849:4181:13036:1 gene:maker-pir_contig_849-snap-gene-0.4 transcript:EPrPIT00000022057 description:"BEACH domain-containing protein lvsA."
Sequence
MSSIHVQPVSWNGYQTSPASHESSSDALQAVHSTTSSLLRVFVDLSSTAAHKVPWAPGVR
FDVSTEGFAYLQIPEVHVRGLLLPTGSGSSSSNSPSIPSFSNASKIWPPADGYSVMLWFR
VDGLETKDEREKLYRECFMTRKCTLCGGILREETSLKCSHRACRPCVDALLLCGGECVIC
NPPMFYLFRFRSGDSKSVSEAFLKGTKVSMRTSASRTVHQFSHAPIEVGKWYHATFVHSR
QRFQSSTVSFYLNGILQETAKISYPSSITSGQPLSGMVGIPSQARRISSSAWTVGPFYLI
DEPAPPFAVNAVYAAGPGYDGLFSGATGNGEIPVCFDHLRVQNLTIIDEYLKDPFRALIE
SVDAERVSKNSFIRGSLSLASAASSTAAAIVQDMKFGSSLFARIPSAVPLINIPIHQERI
LLAYTARNAVGLDSSIIPSSRLDGRPIMQLMGGTATFAPVTVGSALFELCGSGCQVAYVL
LEKASTAKEVELSLRLLCSLMRDSAQNLDAMEQEHGYGIVNYLLHQKASLLGKNTLQLLF
RFAGIDFDNEGDDEGGAREEIRASQGSLVFQASADARESSIRNLQALQYLILDYSLWQKV
DKDTQKLLFSSLYSCLVAGDDELRERNRSQLQSLSVVRQLLYVFLDSDVEPDLVRVIVDL
ILVCLTGAGSRDSSLEANFADVAIFLTSTLSPKFARSRGSKDELALGHQRGMSNEFVRTT
RRLPILSLSLSSKSSTIDKLCLSPRGSKQKRTAHFDTTGKLDSNHTARLRFDDEEEDSHT
RSSSKWRLHQTKVQDLLLDILLKAVQKHDLKESKDRDESDGTVTANENSISVATATFVSN
MASGSAGGAGGMTSASRIQLPSSNRLTGFRRVLSPRWMCYFLFSSTETYCSVSIAPSTVI
LALKLLCALLSRSRYEAFFKKEGYYRLLSQGLPCDQRTFRALNSSKRPQPTRLQSSRFPF
DEMWYTLFCMLLGTPVDGIPHNIQFEMFFLSKDFELNIQSDRILNSNIICVILGIIRRHY
NDPVTTIALQQGSGSIQIEESHFPNLQQQKSAPDEIFHIQVLDFLHYLYGKMPSFHRLLA
VGSDKFRLEFIEELSLLICAASRSQVLEKYSPSEKRVHQTLLNQKRDVNAYEYAICAVTL
AEDAAAKDEHGHDPFSHPTAVRAFQILVDVLMNFLLDFPKGNDVVETFVDSAAGMDLAPP
LNEGLQLRFQSLVMLSLLEQLRTKFDDEAILTEHKLLAQNLRDFLKFVVQKMHNWQRAQH
GDGCPPSFACCNKFHFAGGPGKLLELVLFVLAETSVGIVGGGSGFSVFSSSSSTSLGGLL
QDKLNKGKKRRQIRSIIGRISLSKPAELESLLESLYVTLNAVVLHVLHGHRVEVSDEELA
AMLQLIHVNRDVILGSRNNQDKDFFVCLCRYLLQLLSDSSVSLQEAAVHVWIDLLYFQRS
FMVDLLTIEIRRTGMPPYSVNLMKNGFDVLLECPPTTKSIQGVEQGTGSPALAINSPAFI
KFKKWLELLGPPLKELEISLDRTFLKSVVESKESVREAWIVYHKKLLATNAKHARRFKMR
YEWLLDMEKTLFHSLVEMQNKEFRRQVKWRQDRIDRQKFIARQWHHIQLNLLQHALGCSI
TLEDAQWTAMCNPTLLHDVAMKSSSLLGSRNAGVAADAHSSWRLDFTEGPFRMRKRFSKS
FQQHHLPNKQGSMGIDDVFGDGIQDQDGANSGIVDTLQVITSRRRSKVLRRRFSEGDLAA
FLSDRANSSRAGDLINRKPGRQFTSISKSKPRDNLNERQHGSFEDFFTTTNQRSDDASSV
QSSHSIEQSLQSERKRNSFSMYHDSDGDGDGDDDGGEDRNNTERSGVTAINSGGRLIVEE
EDAIDEKLRPLLMPGDEIMDIYDCLRIDGMDSCPGVFILCNEHAYIVDNYQRLATTQQHI
AAAGRATELDLLGDSESNSQIRVVEISKGATTRLERGLSLRHHHSSQISSEGGGVFGGQI
LNPHTPSNHSSSFMLTRSSFTHQCRFWSYDDIVELHKRRYQLRHVAIEIFAHDGRNYLIT
FESNQQRENVFHSLLNKCPNVRGAASGMDRSVVAGDLYSQLRKLLRNNMTERWIGGEISN
FEYLMHLNTLAGRSYNDLTQYPVFPWVLSDYTSEVIDLNDPSVFRDLTKPMGALNREEEF
RARYDGLSENPDASDVLTSKPFHYGTHYSSAAIVLYYLMRIEPFTTHLLHLQGGKYDHAD
RLFSSVHGAWKSAAGIENAQNGTQDVKELIPEFFYLPAFLKNINEIEFGRDQNGTSVNNV
GLPPWANGSAKEFVRINREALESSFVSSNLHHWIDLIFGYKQQGAAAVDACNVFYHLTYE
GAVDLETISDAAMKRAIVDQINEFGQTPSQLFKTPHPAKTRISPLNGGAMNPTNSLGPNS
FSNDNRAYATMNSSGPSDQATTSSSSLSATFSAASPLTSRAALASSFIGAMESSELMNRV
QTILSSTGLGGSTDDTTRILDEAALLHQEPKREVSMNPLLSSYRGHQHAYTGPAPLRTRQ
LSSGVYAASIQQVSMTTGSVAREEKAAAVGDKCLLIPPRNNEFLAWGFQDRSLKVLSVGA
CEVGSGGESKVIASCEMMVEVNVACITSDGRTIVTGGATSPVIRIWEFSSKKTASSSSSI
AANRRRAYTMGLHTAGQSARSMTALATLVTPAHHQTVTALHACRAYSIAVSGCSGGVIVM
WDLNRMRYMFTLPSFTRLRQHPNSSDKLSEGSFLRAPPEFTSISSICINEVSGDIVVASG
ARFGVYDVNGNLLVRLCYDTLQLDAAFPRSQITSLAVNRSQKSEWSKEKAVITGHADGVL
CIWAYSQSGYGEDEWSIELKGRHVVSTSAVSSPTASRSPVTAVFLTADERKLYTGTSDGL
LSVWTPKSPPAHSQLS
Download sequence
Identical sequences EPrPI00000022057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]