SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EPrPI00000023037 from Pythium irregulare DAOM BR486 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EPrPI00000023037
Domain Number 1 Region: 258-549
Classification Level Classification E-value
Superfamily SPOC domain-like 8.83e-58
Family Ku80 subunit middle domain 0.00056
Further Details:      
 
Domain Number 2 Region: 5-184
Classification Level Classification E-value
Superfamily vWA-like 1.13e-30
Family Ku80 subunit N-terminal domain 0.0034
Further Details:      
 
Domain Number 3 Region: 607-731
Classification Level Classification E-value
Superfamily C-terminal domain of Ku80 6.8e-20
Family C-terminal domain of Ku80 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) EPrPI00000023037
Sequence length 760
Comment pep:novel supercontig:GCA_000387425.2:pir_scaffold_1121:2974:5673:-1 gene:maker-pir_contig_1121-snap-gene-0.9 transcript:EPrPIT00000023037 description:"Autoantigen Ku86."
Sequence
MSRSKEAVVVLLDVGASMRAPLRERATSSRRGSDSEPRTRFDAAVAAIEALIQQKLFFKP
KDEVGIVVYGSEETDNQLNEEQGDDEYRNVMVLWSLDTPTLHMWEKLRALTPARAGSDTK
VDILDGLIVSLDLLFRRTDGKKYEKRLLVITDAAEKITDAGDVDSVVQMMQNMGVKLQII
GIDFINTTDTVKREPSDDVEDSKPVVKDEAASNANNVKVENEKMLVSIANAVDGEVNSVS
KRMQMMAQGMKKTVALTTKFRGNLEIGSELGIPVFCYLKTKVATLPTLVKESQASYEKEE
LGKVKMDRRYTSPQNPDEEVAPDQQVKAYRYGMEKVPFSSADVEFFKFQTEKSLKVLGFL
DRSLLNHSKFVGGTDVFIAEPGKPHAAQALAALIEGMKEQDQVAFARFVARKNAAPKVMA
LIPHSPEKGDNYYGFLAQQLPFEEDLRTYEFAPLKTAKNRPSDAQQDAADKLVESLSVRE
DKADEFGSCFNPVLHRFYQAVSKRAFDDDSSIPPLPEYVETCLNMDETRRQRIQGVIQAF
GNAFQLKEAVRTRNDRKKKSFWSDVAAALPAVKDEPVSGDDADNGPDQNDDDAGSDIDLD
GLLDSGDVTSVGSMNPVADFEALVDMSKSNRSKLVTAVSGMESRIESFLTSGASFHRKAL
QCLAHFRNRSVEIHYSSQFNDFLTRLKAKVGESSDVWKAVEQEGITLLSSEDDPSLNVTP
AQAQAFLYGEEQVDVSSAAASLPSQVEKMEQEDDMFAEFE
Download sequence
Identical sequences EPrPI00000023037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]