SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297627302|ref|YP_003689065.1| from Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297627302|ref|YP_003689065.1|
Domain Number 1 Region: 53-146
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 8.5e-20
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297627302|ref|YP_003689065.1|
Sequence length 160
Comment hypothetical protein PFREUD_21490 [Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1]
Sequence
MGDNTEDRSVDASASPTNAAASTPDAGNYRDLPQALPPADLVALNDPSGTPSTLAFRMIA
LAGEARSLAMRAIAAAESGGFVDAESLIEQAHCSYDRAHQVQKALTEAHRRDIQPAVDLL
LVHAHDHLVMAQMALDNAEIITRLYRRITALEAEPRLTRE
Download sequence
Identical sequences A0A170QF66 A0A2C8ACC0 D7GGJ0
WP_013161985.1.29476 WP_013161985.1.30516 WP_013161985.1.45898 WP_013161985.1.47803 WP_013161985.1.58851 WP_013161985.1.67466 WP_013161985.1.82752 gi|297627302|ref|YP_003689065.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]