SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|301055840|ref|YP_003794051.1| from Bacillus cereus biovar anthracis str. CI

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|301055840|ref|YP_003794051.1|
Domain Number 1 Region: 31-167
Classification Level Classification E-value
Superfamily Homing endonucleases 3.4e-30
Family Group I mobile intron endonuclease 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|301055840|ref|YP_003794051.1|
Sequence length 182
Comment endonuclease [Bacillus cereus biovar anthracis str. CI]
Sequence
MGRDNKDIVKRKVYRSKWERGLIITERVPKNIDPFITGIIVGFTMGEGSFYVRIGQSKTY
VCGYSIQPAFSITLKRSDKKFLTFISKKLKCGKLTVRKNVVEYTVVNFTDIVEVIIPFFS
KYPLKNVKAKDFLFFKIICYKIMNGEAKRKEGIKKILSIRKYMNDGGTKIRKYQDIYKED
DS
Download sequence
Identical sequences D8GW84
gi|301055840|ref|YP_003794051.1| WP_000532211.1.71895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]