SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|403522798|ref|YP_006658367.1| from Burkholderia pseudomallei BPC006

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|403522798|ref|YP_006658367.1|
Domain Number 1 Region: 2-345
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 8.74e-103
Family FMN-linked oxidoreductases 0.00000000191
Further Details:      
 
Domain Number 2 Region: 317-506
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.3e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000556
Further Details:      
 
Domain Number 3 Region: 446-504,540-634
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.81e-19
Family C-terminal domain of adrenodoxin reductase-like 0.0000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|403522798|ref|YP_006658367.1|
Sequence length 656
Comment FAD/FMN-binding/pyridine nucleotide-disulfide oxidoreductase family protein [Burkholderia pseudomallei BPC006]
Sequence
MKNRVLMGSMHVGLEEAANGFERMAAFYAERARGEAGLIVTGGIAPNERGRMMPGGSMLT
TEEEAERHRIVTRAVHDAGGRIAMQILHFGRYAYHPALVAPSALKAPINTFTPHALSASE
VDATIDDFARCAALAQYAGYDGVEIMGSEGYLINEFIAAHTNHREDEWGGAYENRIRFPV
EIVRRVRERVGTNFIIIYRLSMLDLVEGGSTLDEVIRLAQAVEAAGATILNTGIGWHEAR
IPTIATKVPRAAYAWVTKRLVGRVGIPLVATNRINTPEIAEQLLAEGYCDMVSMARPFLA
DAQFVRKAREGRADEINTCIGCNQACLDHIFSGRITSCLVNPRACHETELVIEPAERRKR
IAVVGAGPAGLSFAVTAAERGHDVELFEASPEIGGQFNIAKKVPGKEEFHETLRYFRRQL
ELRGVTLHLNTRADVARLAGGGFDEIVLATGVTPRRPDIEGIGHARVMGYLDVLRDGKPV
GASVAVIGAGGIGFDVSEYLTHTGESASVAPSTFYAQWGIDVDYGARGGVRMPHVEAAPR
NVHLLQRKASKVGDGLGKTTGWIHRTSLKARRVAMSSGVSYERIDDAGLHVRIDGEPRTL
AVDSVVVCAGQEPQRELYDGLRAAGCSVHLIGGAHVAAELDAKRAILQGTTLAASI
Download sequence
Identical sequences gi|403522798|ref|YP_006658367.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]