SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|403523817|ref|YP_006659386.1| from Burkholderia pseudomallei BPC006

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|403523817|ref|YP_006659386.1|
Domain Number 1 Region: 1-368
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.44e-107
Family FMN-linked oxidoreductases 0.0000000021
Further Details:      
 
Domain Number 2 Region: 335-522
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 8e-42
Family N-terminal domain of adrenodoxin reductase-like 0.0000162
Further Details:      
 
Domain Number 3 Region: 464-522,558-655
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.48e-24
Family C-terminal domain of adrenodoxin reductase-like 0.000098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|403523817|ref|YP_006659386.1|
Sequence length 677
Comment FAD/FMN-binding/pyridine nucleotide-disulfide domain-containing oxidoreductase [Burkholderia pseudomallei BPC006]
Sequence
MTTPFPHLLAPLDLGFTTLRNRVLMGSMHTGLEDSRKTLPRLADYFAERARGGVGLIVTG
GFAPNVAGWTKPFGGTLSTGAAARRHRVIPDAVHAHGGKIALQILHTGRYGYHPFAVAPT
RLKSPISPFTPHELSARGIERQIRAFVRCAQLAREAGYDGVEIMGSEGYLINQFISLHTN
KRTDEWGGSYANRMRLPVEIVERTREAVGRDFIIVYRLSMLDLIPDGSNWDEVVLLAKAV
ERAGATIINTGIGWHEARVPTIATSVPRGAFAWVTKKMKGEVGIPLVTTNRINRPEIAEQ
ILADGCADMVSMARPFLADAEFVKKAAEGRVDEINTCIGCNQACLDHAFKNQIASCLLNP
RACHETELNYTRAASAKRVAVIGAGPAGLACATVLAQRGHRVELFDAAAEIGGQFNMAKR
IPGKEEFHEALRYFARQIELAGVQLRLNRRVDAAELIAAGYDDVVLATGVAPRNPRIPGQ
DHPKVLTYIDVLARNKPVGERVAVIGAGGIGFDVSEFLVQDGESPALDLDAWKAEWGVTD
PALARGGVVRGEVAPPARRITLLQRKATGLGKGLGKTTGWIHRATLKMKQVEMIGGVNYE
LIDDKGLHVTFGKERRDPTVIEADTIVLCAGQEPERALYEPLKAAGVPVHLIGGAELAAE
LDAKRAIDQGARLAARL
Download sequence
Identical sequences A0A095FN10 A0A0E1UW19 A0A0H3HWN4 A3P8E5 B1H870 C4I975 Q63J18
272560.BPSS1898 357348.BURPS1106A_A2575 gi|126456009|ref|YP_001076605.1| gi|53722919|ref|YP_111904.1| gi|403523817|ref|YP_006659386.1| WP_004530263.1.100195 WP_004530263.1.100583 WP_004530263.1.100720 WP_004530263.1.100825 WP_004530263.1.100900 WP_004530263.1.101783 WP_004530263.1.10359 WP_004530263.1.10907 WP_004530263.1.11160 WP_004530263.1.11268 WP_004530263.1.11893 WP_004530263.1.11996 WP_004530263.1.11998 WP_004530263.1.12793 WP_004530263.1.12856 WP_004530263.1.12860 WP_004530263.1.13309 WP_004530263.1.13504 WP_004530263.1.13520 WP_004530263.1.13603 WP_004530263.1.13639 WP_004530263.1.14539 WP_004530263.1.15170 WP_004530263.1.15364 WP_004530263.1.15525 WP_004530263.1.15673 WP_004530263.1.16113 WP_004530263.1.16249 WP_004530263.1.16358 WP_004530263.1.16540 WP_004530263.1.16625 WP_004530263.1.16689 WP_004530263.1.17786 WP_004530263.1.18631 WP_004530263.1.18704 WP_004530263.1.19629 WP_004530263.1.1976 WP_004530263.1.21147 WP_004530263.1.21205 WP_004530263.1.21461 WP_004530263.1.21907 WP_004530263.1.22299 WP_004530263.1.22308 WP_004530263.1.23009 WP_004530263.1.23994 WP_004530263.1.24020 WP_004530263.1.24134 WP_004530263.1.24372 WP_004530263.1.24513 WP_004530263.1.24701 WP_004530263.1.25102 WP_004530263.1.25412 WP_004530263.1.25628 WP_004530263.1.26565 WP_004530263.1.26633 WP_004530263.1.27069 WP_004530263.1.27146 WP_004530263.1.27363 WP_004530263.1.27399 WP_004530263.1.27420 WP_004530263.1.27441 WP_004530263.1.2767 WP_004530263.1.27810 WP_004530263.1.28066 WP_004530263.1.28594 WP_004530263.1.29161 WP_004530263.1.29335 WP_004530263.1.29405 WP_004530263.1.29520 WP_004530263.1.29547 WP_004530263.1.29658 WP_004530263.1.29853 WP_004530263.1.29887 WP_004530263.1.29899 WP_004530263.1.29948 WP_004530263.1.30311 WP_004530263.1.30671 WP_004530263.1.3069 WP_004530263.1.30937 WP_004530263.1.31343 WP_004530263.1.32174 WP_004530263.1.32221 WP_004530263.1.324 WP_004530263.1.33077 WP_004530263.1.33130 WP_004530263.1.33157 WP_004530263.1.34230 WP_004530263.1.34333 WP_004530263.1.35141 WP_004530263.1.35249 WP_004530263.1.35474 WP_004530263.1.35491 WP_004530263.1.36106 WP_004530263.1.36174 WP_004530263.1.366 WP_004530263.1.36662 WP_004530263.1.36666 WP_004530263.1.36944 WP_004530263.1.37 WP_004530263.1.37373 WP_004530263.1.37519 WP_004530263.1.37535 WP_004530263.1.37627 WP_004530263.1.37690 WP_004530263.1.37994 WP_004530263.1.38115 WP_004530263.1.38490 WP_004530263.1.3872 WP_004530263.1.39078 WP_004530263.1.39162 WP_004530263.1.39179 WP_004530263.1.3947 WP_004530263.1.39757 WP_004530263.1.40448 WP_004530263.1.41945 WP_004530263.1.42408 WP_004530263.1.42492 WP_004530263.1.43136 WP_004530263.1.43373 WP_004530263.1.43727 WP_004530263.1.43786 WP_004530263.1.44414 WP_004530263.1.46575 WP_004530263.1.46757 WP_004530263.1.46829 WP_004530263.1.47086 WP_004530263.1.47149 WP_004530263.1.48464 WP_004530263.1.49026 WP_004530263.1.49717 WP_004530263.1.50636 WP_004530263.1.50839 WP_004530263.1.51606 WP_004530263.1.5173 WP_004530263.1.5182 WP_004530263.1.52229 WP_004530263.1.52521 WP_004530263.1.52547 WP_004530263.1.52643 WP_004530263.1.52655 WP_004530263.1.52731 WP_004530263.1.5292 WP_004530263.1.53048 WP_004530263.1.53103 WP_004530263.1.53132 WP_004530263.1.5338 WP_004530263.1.54016 WP_004530263.1.5413 WP_004530263.1.54369 WP_004530263.1.54804 WP_004530263.1.54859 WP_004530263.1.55038 WP_004530263.1.55974 WP_004530263.1.55996 WP_004530263.1.5608 WP_004530263.1.5641 WP_004530263.1.56451 WP_004530263.1.56591 WP_004530263.1.56744 WP_004530263.1.57046 WP_004530263.1.57096 WP_004530263.1.57247 WP_004530263.1.57341 WP_004530263.1.5776 WP_004530263.1.58003 WP_004530263.1.58190 WP_004530263.1.58578 WP_004530263.1.59103 WP_004530263.1.59255 WP_004530263.1.59422 WP_004530263.1.59496 WP_004530263.1.59536 WP_004530263.1.60810 WP_004530263.1.60833 WP_004530263.1.61084 WP_004530263.1.61723 WP_004530263.1.6186 WP_004530263.1.63097 WP_004530263.1.63379 WP_004530263.1.63942 WP_004530263.1.64068 WP_004530263.1.64204 WP_004530263.1.64364 WP_004530263.1.64383 WP_004530263.1.64542 WP_004530263.1.64892 WP_004530263.1.65093 WP_004530263.1.65270 WP_004530263.1.65832 WP_004530263.1.66257 WP_004530263.1.67117 WP_004530263.1.67559 WP_004530263.1.6765 WP_004530263.1.67860 WP_004530263.1.68515 WP_004530263.1.68886 WP_004530263.1.69081 WP_004530263.1.69094 WP_004530263.1.69354 WP_004530263.1.69918 WP_004530263.1.7006 WP_004530263.1.70066 WP_004530263.1.70278 WP_004530263.1.71392 WP_004530263.1.71444 WP_004530263.1.71564 WP_004530263.1.71901 WP_004530263.1.72015 WP_004530263.1.72083 WP_004530263.1.72817 WP_004530263.1.73521 WP_004530263.1.73576 WP_004530263.1.73974 WP_004530263.1.74425 WP_004530263.1.74690 WP_004530263.1.75027 WP_004530263.1.75075 WP_004530263.1.75519 WP_004530263.1.75711 WP_004530263.1.75776 WP_004530263.1.75883 WP_004530263.1.75937 WP_004530263.1.76142 WP_004530263.1.76290 WP_004530263.1.766 WP_004530263.1.77249 WP_004530263.1.77689 WP_004530263.1.78029 WP_004530263.1.78628 WP_004530263.1.78807 WP_004530263.1.79052 WP_004530263.1.79360 WP_004530263.1.79725 WP_004530263.1.80302 WP_004530263.1.80395 WP_004530263.1.80433 WP_004530263.1.80923 WP_004530263.1.81042 WP_004530263.1.81543 WP_004530263.1.81665 WP_004530263.1.82394 WP_004530263.1.82506 WP_004530263.1.82950 WP_004530263.1.83357 WP_004530263.1.8341 WP_004530263.1.83543 WP_004530263.1.83567 WP_004530263.1.83609 WP_004530263.1.83688 WP_004530263.1.84002 WP_004530263.1.84026 WP_004530263.1.84375 WP_004530263.1.84866 WP_004530263.1.85412 WP_004530263.1.85584 WP_004530263.1.85774 WP_004530263.1.86438 WP_004530263.1.86525 WP_004530263.1.86806 WP_004530263.1.8697 WP_004530263.1.87114 WP_004530263.1.87278 WP_004530263.1.87324 WP_004530263.1.87553 WP_004530263.1.87652 WP_004530263.1.88003 WP_004530263.1.88117 WP_004530263.1.88237 WP_004530263.1.89514 WP_004530263.1.90934 WP_004530263.1.91025 WP_004530263.1.91142 WP_004530263.1.92367 WP_004530263.1.92430 WP_004530263.1.92493 WP_004530263.1.93844 WP_004530263.1.94121 WP_004530263.1.94286 WP_004530263.1.94498 WP_004530263.1.94520 WP_004530263.1.94901 WP_004530263.1.95300 WP_004530263.1.95587 WP_004530263.1.95644 WP_004530263.1.95672 WP_004530263.1.95938 WP_004530263.1.97058 WP_004530263.1.97112 WP_004530263.1.98547 WP_004530263.1.98688 WP_004530263.1.98768 WP_004530263.1.98944 WP_004530263.1.99160 WP_004530263.1.99290 WP_004530263.1.9962 WP_004530263.1.99629 WP_004530263.1.9983 WP_004530263.1.99890 YP_111904.1.59693 gi|386865714|ref|YP_006278662.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]