SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|403521937|ref|YP_006657506.1| from Burkholderia pseudomallei BPC006

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|403521937|ref|YP_006657506.1|
Domain Number 1 Region: 2-156
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.43e-26
Family Phosphate binding protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|403521937|ref|YP_006657506.1|
Sequence length 164
Comment LysR family regulatory protein [Burkholderia pseudomallei BPC006]
Sequence
MVRVGALEDSGLVARRVGAMAPCTCATPAYLQRYGVPETLDALDGHVGVHYTSMNTGKAR
VWCFIDDGEPKTVAMKGAVSVNDADAYVAAVLAGLGLGKASRYLVEPHPRTGALRRVPCR
FDEPARPVSILPLPNRNLPHKVRVFIEWLSARFERHDGLRPPAG
Download sequence
Identical sequences A0A1S0SQC3 A3P2T0
gi|403521937|ref|YP_006657506.1| 357348.BURPS1106A_A0604 gi|126458015|ref|YP_001074640.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]