SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298207008|ref|YP_003715187.1| from Croceibacter atlanticus HTCC2559

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298207008|ref|YP_003715187.1|
Domain Number 1 Region: 439-544
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.14e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298207008|ref|YP_003715187.1|
Sequence length 550
Comment permease of sulfate transporter [Croceibacter atlanticus HTCC2559]
Sequence
MITFKHFKGDLFGGLTAGVVALPLALAFGVQSGMGAAAGLYGAIAVGIFAAAFGGTQTQA
SGPTGPMTVVTAALVVAAIELTGSLEAGMGIILATFVFAGLIQIVFGFLNIAGYVKYFPY
PVISGFMSGIGLIIIILQIFPFVGLDSAKSTIKIMKDLPRLFAEFNPQALLLGSITIAVY
IIWPKINKAIPTALVALIVATLIGYFFNFDVPLIKDIGEIPSFLELKIDTILGIDLNAFS
IILEYAFILALLGSIDSLLTSVIADSMTKTKHNSNRELIGQGIGNAIGGLIGGIPGAGAT
KGTVVNINAGGTTRLSGMIHGLFLLAVLLGLGFLASEIPLCVLAGILIPIGFKIIDIKGL
KHLLKVPKGDAFVMILVLLMTTFGSLIQAVGIGVALACLLFMKKSGDMAERGLTTGTLSD
IDDNDSKWKTEGNFYETNKEKILIKRLYGPLFFGFTSYFKDEVKRNSKDKSVVIFRMDRV
PYIDQSGVYALEDIITDLEGKGIEVLLVGLDTQPRKMLEAVGIIPKLIQEQDIFDTIYDC
LEYLKLQLSD
Download sequence
Identical sequences A0A2E4ZLF4 A3U5J3
gi|298207008|ref|YP_003715187.1| WP_013186188.1.96744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]