SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298209005|ref|YP_003717184.1| from Croceibacter atlanticus HTCC2559

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|298209005|ref|YP_003717184.1|
Domain Number - Region: 3-79
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0589
Family Sfri0576-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298209005|ref|YP_003717184.1|
Sequence length 264
Comment hypothetical protein CA2559_12213 [Croceibacter atlanticus HTCC2559]
Sequence
MDINKYIESGILELYVYGALTQAEAEEVSKVLHQYPEVHKEVEEIETALKSLSTHVAPYN
PETVLADIKRKLNHTGKVVSIAPKKSYNMPAIIGWAASIALIGGLFYTLNETNNLREDLR
YQKTQNVLVNSKYEQAELELTQTKDLLTIVRSNEYIKVPLGAQAVDKDAYASVYWNTKTN
TAYIDAQGLPKPPKGKVYQVWSLKLDPLTPTSLGLLTENESQSSQIYKLDNSNTSEAFGI
TLEPEGGSESPTLEQLYVLGAVGA
Download sequence
Identical sequences A3UAG5
WP_013188182.1.96744 gi|298209005|ref|YP_003717184.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]