SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298207187|ref|YP_003715366.1| from Croceibacter atlanticus HTCC2559

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298207187|ref|YP_003715366.1|
Domain Number 1 Region: 94-241
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 2.1e-32
Family Flavohemoglobin, C-terminal domain 0.066
Further Details:      
 
Domain Number 2 Region: 234-346
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 6.82e-28
Family 2Fe-2S ferredoxin-related 0.011
Further Details:      
 
Domain Number 3 Region: 4-108
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.05e-24
Family Ferredoxin reductase FAD-binding domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|298207187|ref|YP_003715366.1|
Sequence length 349
Comment Phenylacetate-CoA oxygenase/reductase, PaaK subunit [Croceibacter atlanticus HTCC2559]
Sequence
MDAFQFLRIKDIIRETPQAVSLVFEVPSVLKDNYKFKAGQYLTFKMMLNGEEIRRSYSLC
STPKSGELKVTVKEVEDGTFSTYANNKLKVGDSLEVHTPEGKFIYEPNNTSQHNYAAFAA
GSGITPILSILKTALEEEPTSKFVLVYGNRTPQETIFYKELLELQANYASRLFIEFVYSQ
SQEDASHFGRIEKSTVNFIVKNRYKDYTFKDVFLCGPEKMIENVTDVLKENNISEENIHF
ELFTSNTEGSIEADLEGNTEVVVMLDDEETTFTMKKSESILDAVLNQDLDPPYSCQGGIC
SSCIARLTEGKAEMRKNQILTDDEVAEGLILTCQAHPTTPKVVVDFDEV
Download sequence
Identical sequences A3U623
gi|298207187|ref|YP_003715366.1| WP_013186367.1.96744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]