SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298209092|ref|YP_003717271.1| from Croceibacter atlanticus HTCC2559

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298209092|ref|YP_003717271.1|
Domain Number 1 Region: 6-192
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.93e-55
Family Methylesterase CheB, C-terminal domain 0.0000862
Further Details:      
 
Domain Number 2 Region: 273-467
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.37e-45
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00069
Further Details:      
 
Domain Number 3 Region: 1041-1199
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.62e-34
Family Histidine kinase 0.0015
Further Details:      
 
Domain Number 4 Region: 200-275
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0000000000000157
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0054
Further Details:      
 
Domain Number 5 Region: 970-1050
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000000314
Family Homodimeric domain of signal transducing histidine kinase 0.0029
Further Details:      
 
Domain Number 6 Region: 833-960
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000297
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.062
Further Details:      
 
Domain Number 7 Region: 709-829
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000609
Family Heme-binding PAS domain 0.072
Further Details:      
 
Weak hits

Sequence:  gi|298209092|ref|YP_003717271.1|
Domain Number - Region: 635-730
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 0.0536
Family Chemotaxis phosphatase CheZ 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298209092|ref|YP_003717271.1|
Sequence length 1200
Comment signal transduction histidine kinase [Croceibacter atlanticus HTCC2559]
Sequence
MNSISDNHILVALGASAGGLEALNSFFYNVPEDSDYTYLIVQHLSSDHKSLMAELLAKKT
KIPVTEIQQNTEIERNHIYVIPPSKNLVIENKHLKLLDKPKGQQLNLPIDILFESLAKEY
RQNAVGVILSGTGSDGSRGIRYIKEEGGLVLVQHPEDSKFGGMPQSAINTGFPDFVVPVE
DMSNEITSYFDSSNILSITQDFTNIDDSALRDILSLLKSKTEIDFNLYKRPTLLRRIIRR
MRIHQLESLREYYKHLKNSKDEVDIIYKEFLIGVTKFFRDEEMWRLLENNVIPKLVADKQ
ENDILKIWDVACSTGEETYSLAILFLEEIAKQKKNIELKIFATDISQFHLDIASKGEYSK
STLVNVDPKYLARYFKKDDDTFKIAETVRRTAIFSNHNILKDPPFNKVDMVMCRNLLIYF
QNDVQQKVFNVLHFSLKLEGYLVLGSSESLGDERDNFDTISRKWKIFKNIKASRGLRTET
LHASSDRKFRNKRRTNPDIVANSNMKQRKIEELLSSSILKQFNATSIYIDEDYNILEARG
NFRKFANLPNSGFTTNLLKMLPEEFKIPLTTSIKRSKRLKDTQVISERIIFVNDDGQTAV
DLRVLPILDDNSNKVTEFVVSLMDQNIESINETVIERTSISESATLRIKDLEEEIDLVQD
ELNKAIEDTEISNDKLLATNEELLASNEELQCTNEELQSVNEELNTINTDHIQKLDELSA
LNEDINNLLTSTNLGVIFLDAKLRVRKFTPAIKEHFDLYQADLGRHIDNFVVSFGENNTN
NIVTNAERVINTGKVFEKKIISKNNRHFLQRISPYITTAGEINGAVVTFIDIERIHKSQE
ELRRNQAKFKDFYENDPVMHASISPDSGNIVDCNKIFYKTLGFKNKKEILNKSIFHFYND
QSKIKASDLINEIKNTGQIQNEDMTLVAIDGREIHVLLNSKLTKNIHGETITMGTLIDIT
ALKETADKLAKRQLDLEMANNDLEQFVSICSHDLKEPLATIRFGSEMLDKNFSHQLESKG
KEYIRYIHEAAGRLANQINALLEHSRIGQNSEKQDVDLKQVLDTVVMDLAKSINDCKAKI
SIAKLPTIKGYEVELRLLFQNLLSNALKYCKKGVTPDIRISYFKDNDHYIFSVNDNGIGI
EEIDLENIFKIFNKIHRNDNIEGTGIGLAHCDKIVKLHDGKIWVDSQPGVGSTFHFKLKA
Download sequence
Identical sequences A3UAQ2
gi|298209092|ref|YP_003717271.1| WP_013188269.1.96744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]