SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397771988|ref|YP_006539534.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|397771988|ref|YP_006539534.1|
Domain Number - Region: 171-215
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.000272
Family MJ1460-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397771988|ref|YP_006539534.1|
Sequence length 217
Comment hypothetical protein NJ7G_0203 [Natrinema sp. J7-2]
Sequence
MATIETVFVTTSWFKRLIGGSDDESQSPDELPTVSDRIGFDGSLEDAEVIGRSPLSYVAA
GESISSFVGKQIANKLAEHGLENIEPDEWYSLKIPLAMLYDMRDEYGSLRMQNMGQNVPQ
HVEFPPEISEVDSALASIEEAYHQNHRGSEIGSYEFETEGPNEGVMVCENPYPCEFDKGL
IKGVAKKFANNPVDVQEIGDQCRSDGDQHCTYHVEWR
Download sequence
Identical sequences I7CNE6 L9YWV1
gi|397771988|ref|YP_006539534.1| WP_008456596.1.263 WP_008456596.1.60908 WP_008456596.1.66429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]