SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397772333|ref|YP_006539879.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397772333|ref|YP_006539879.1|
Domain Number 1 Region: 1-177
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.96e-24
Family H-NOX domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397772333|ref|YP_006539879.1|
Sequence length 179
Comment Heme NO binding domain protein [Natrinema sp. J7-2]
Sequence
MHGIVHKTLKEYVVERTDDGTWDTIVEQSGFEPKLYLPVSHYDDREIDAILETLSTMATQ
DRRAIERDFGTTLAPKLLSTFSAHIKRDWDLPELLAGLEDVYDDIEAATEDTALPELSCT
SEADHAIVSYDTHRDQQYCGLAHGILEGVVAAFGADAAVTETACVDDGADACRFRVDLE
Download sequence
Identical sequences I7CPA5 L9Z1Q0
gi|397772333|ref|YP_006539879.1| WP_008456006.1.263 WP_008456006.1.60908 WP_008456006.1.66429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]