SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|397774414|ref|YP_006541960.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397774414|ref|YP_006541960.1|
Domain Number 1 Region: 7-103
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000786
Family Transcription factor MotA, activation domain 0.072
Further Details:      
 
Weak hits

Sequence:  gi|397774414|ref|YP_006541960.1|
Domain Number - Region: 119-228
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0283
Family Nuclease 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397774414|ref|YP_006541960.1|
Sequence length 271
Comment TrmB family transcriptional regulator [Natrinema sp. J7-2]
Sequence
MTEDTTTREAISLLQDLGLQEYEARCFMALNKLPSGTAKEIHEISDVPRTRVYDAIRVLE
SQGLVEVQHTSPQVYRAVSIDEATQTLRQKYDTRIETLETHLRNTDVREADEDDQVQEVW
SLTGHEAIESRTIELIDEAESEIALIVVDEDILSESLFDGLQTAADRDISLVLGGQTDTV
TETLGDRLSTTHVFETGLDWLTGIERDDEVAISRILLVDRETLLVGSYYPNTAGSDANEQ
AVFARGLENGIVVLLRRLVTAGLPQIKDPGA
Download sequence
Identical sequences I7CJJ7
gi|397774414|ref|YP_006541960.1| WP_014864600.1.66429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]