SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397774568|ref|YP_006542114.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397774568|ref|YP_006542114.1|
Domain Number 1 Region: 276-532
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 4.32e-39
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00011
Further Details:      
 
Domain Number 2 Region: 19-162
Classification Level Classification E-value
Superfamily Globin-like 7.91e-29
Family Globins 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397774568|ref|YP_006542114.1|
Sequence length 547
Comment chemotaxis sensory transducer [Natrinema sp. J7-2]
Sequence
MQPQETFGRDGLNGFLDVDDLVDRIELDDDEIAWRKAFIGFDEADEQRLAALEPLLQANA
EAIADDFYENVFHYEQTRAIVDRSPKNVDALKQTQQAYLVSLATGDYDQEFFKNRARIGK
LHELLDMPLKQYVGQYGVYYDLIMSRLNERVQQQVVDAIEEWAAERDTEDDGGLDRFVGA
LGLGGSGEDQSDGLEESLEETVRDAIDDGMMDVLSLLRIINLDMQVAVDTYVDSYAQRLE
DSIERRERLAREVETDVEAPIAELHDSSEVVAQRAEAISEQTDSQATGITRAAGELNEMS
AAIEEVASVADEVSEESDRTETLAAQGVEAADDALDELAAIEDATDRVADAVDTLADRTE
EIDEIVDRLDELAERTTVLAANAKIESSRDDADGSETMGIIASEVRSFAEQTKSDLAEIE
DAVEAVRQDAAATVETTEETVTRVDTGTDRVRETVDSLEEIHESARTTAAGMEDVATATD
QQARGVEVTAETLEDLSESADTVASAAESVAAASQQQTASLREVRESVARLTEADADDEP
PVYERYD
Download sequence
Identical sequences I7CV58
gi|397774568|ref|YP_006542114.1| WP_014864717.1.60908 WP_014864717.1.66429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]