SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397774994|ref|YP_006542540.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397774994|ref|YP_006542540.1|
Domain Number 1 Region: 170-322
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 6.76e-34
Family Mevalonate 5-diphosphate decarboxylase 0.035
Further Details:      
 
Domain Number 2 Region: 2-160
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.95e-32
Family GHMP Kinase, N-terminal domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397774994|ref|YP_006542540.1|
Sequence length 322
Comment diphosphomevalonate decarboxylase [Natrinema sp. J7-2]
Sequence
MAHPIQGLVKYHGMRDDIERLPYHDSISVCTAPSHTRTTVEFSMDHEEDTFVVDGEELDG
RAYERVEAVVEKARSKSDAAHTVYPVRLESENSFPSNVGLGSSSSGFAAAAMALAEAAEL
DASKQEISTIARVGSASAARAVTGAFSQLHTGLNDADCRSKRVPSDLHEELKIIVGLVPY
HKETEDAHREAADSHMFQARNAHIHGQIAEMRDALRNNEFERAFELAEHDSLSLAATTMT
GPSGWVYWQPATLAVFNTVRELREEDDIPVYFSTDTGASVYVNTTEEHAEEVEEAVADCG
VSTTTWDVGGPARLLDEDDHLF
Download sequence
Identical sequences I7CL12
gi|397774994|ref|YP_006542540.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]