SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397774999|ref|YP_006542545.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397774999|ref|YP_006542545.1|
Domain Number 1 Region: 9-61,201-402
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.74e-47
Family Bacterial dinuclear zinc exopeptidases 0.01
Further Details:      
 
Domain Number 2 Region: 78-189
Classification Level Classification E-value
Superfamily PA domain 0.00000000000288
Family PA domain 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|397774999|ref|YP_006542545.1|
Sequence length 436
Comment peptidase M28 [Natrinema sp. J7-2]
Sequence
MSDWIGTVFRSDAGWNHLEGLVDIGNRMAGSEGEREAAELTRDALADAGARNARLESFEI
QGWTREDSAITAGDTTQDCIALPRSPDDRVVAPLIDLGYGLPADFEETDVEDAIVMVRSD
VPDYYDRYIHRREKYHYAVEQGAAGFVYRNHVEGCLPPTGSVGWHDEPIGPIPAVGVSSE
VGARLGRRFDGESITVSVEATIQPAESQNVHAELGPDTDERILVTSHVDAHDIAEGAMDN
GAGTAMIVELATALAAREDDLETRVEFVGFGAEEVGLLGSRRYAERADHDAIKAVVNSDG
VVRDRTLSIVTHGFDALADAANEVADRYDHPIGTVPKLGPHSDHWSFVKWGVPGCHVKSM
SDGAGRGWGHTFADTIEKLEPRTLREQAILLTDYVVALAREDVSVARRDREAIAADLESQ
DLAEGMRITGDWPYDD
Download sequence
Identical sequences I7CL36
gi|397774999|ref|YP_006542545.1| WP_014865059.1.60908 WP_014865059.1.66429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]