SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397774435|ref|YP_006541981.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397774435|ref|YP_006541981.1|
Domain Number 1 Region: 14-303
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.09e-52
Family Diacylglycerol kinase-like 0.0000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|397774435|ref|YP_006541981.1|
Sequence length 323
Comment diacylglycerol kinase catalytic region [Natrinema sp. J7-2]
Sequence
MDGSMTPVETSDRVLVLNPVSGSGDHVDDVVELAADHGFEIRRTEQGGDATRFAREAAPE
AALVAAAGGDGTLNAVVNGVAAANALETTTVAVVPAGTGNNFATNVGIRGLEHAFTVIED
GRRRAIDVAMANGRRFVNSCVGGITAEASSDTTTESKADLGVLAYVKNTIETVGEFDSLP
LRVETAAGPNGETAQSWEGEALFVLIGNCRRFTGARTAQANVEDGLLEVTIVEDAATTDL
LGGAALEGLLGQDSTHIVRRRTPSLAIDSRADSIEYSLDGEILETETVRIETDPGALTLP
VGDGYRPDPDDEERWPIGTPANQ
Download sequence
Identical sequences I7BY56
WP_014864617.1.66429 gi|397774435|ref|YP_006541981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]