SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|397774801|ref|YP_006542347.1| from Natrinema sp. J7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|397774801|ref|YP_006542347.1|
Domain Number 1 Region: 64-136
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.75e-20
Family Ribosomal protein L11, C-terminal domain 0.0000262
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 1.13e-19
Family Ribosomal L11/L12e N-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|397774801|ref|YP_006542347.1|
Sequence length 162
Comment Ribosomal protein L11-like protein [Natrinema sp. J7-2]
Sequence
MAGTIEVLVPGGQANPGPPLGPELGPTPVDVQAVVQEINDQTEAFDGTEVPVTVDYEEDG
SFEIDVGVPPTAALIKDEAGFETGSGEPQTDFVADLSVDQVKKIAEQKHPDLLAYDTINA
AKEVVGTCASMGVTIEGNDAREFKQRVDDGEYDDVLASEASA
Download sequence
Identical sequences I7CZH4 L9YSC1
gi|397774801|ref|YP_006542347.1| WP_008458427.1.263 WP_008458427.1.60908 WP_008458427.1.66429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]