SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296128885|ref|YP_003636135.1| from Cellulomonas flavigena DSM 20109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296128885|ref|YP_003636135.1|
Domain Number 1 Region: 63-245
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.18e-38
Family Phosphoglucomutase, first 3 domains 0.0013
Further Details:      
 
Domain Number 2 Region: 335-488
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.59e-24
Family Phosphoglucomutase, first 3 domains 0.0045
Further Details:      
 
Domain Number 3 Region: 239-343
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 6.28e-21
Family Phosphoglucomutase, first 3 domains 0.0024
Further Details:      
 
Domain Number 4 Region: 490-583
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 7.59e-16
Family Phosphoglucomutase, C-terminal domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|296128885|ref|YP_003636135.1|
Sequence length 614
Comment Glucose-1,6-bisphosphate synthase [Cellulomonas flavigena DSM 20109]
Sequence
MSTDDLGDLAARVEEWVADDPDPDTAAELTRLLRVARDAPPEGAAAPEADLARADARVAR
AELADRFSGLLQFGTAGLRGALGGGPHRMNRAVVIRAAAGLAHFLRGELEGVVPAPRVVV
GYDARHNSHRFALDTAAVMTAVGIDVLLLPRALPTPVLASAVRRFDADAGVMVTASHNPP
QDNGYKVYLGGRVVTDAGQGAQIVPPADAAIAAEIARVPSVASVPRASSGWTTLGEEVVD
AYARDAAAVAPGGDPRARADLTVVLTPLHGVGGRVAQDVLARAGFTDVTLVPEQAEPDPD
FPTVAFPNPEEPGATDLALALAASLRADLVVAVDPDADRCAVAVLDPRAHRAAVGPQTPQ
ADGWRMLTGDEVGALLGADAAARTRAAGDPAGATLACSIVSSRLLEAVATGAGLRFASTL
TGFKWISRVDGLVFGYEEALGYCVDPAHVRDKDGISAAVRVCDLAARLAAEGRTLVDALD
DLARAHGLHATGQVSARFADLGRIGATMTALRESPPTTLVGSPVVQVVDLAAGTDDERGG
LPPTDGLRLLTADGTRVVVRPSGTEPKVKAYLEVVVDVARDADRDALDAAHRTARERLDH
LARDVRTALGLDRP
Download sequence
Identical sequences D5UKW8
gi|296128885|ref|YP_003636135.1| WP_013116270.1.68649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]