SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|296131514|ref|YP_003638764.1| from Cellulomonas flavigena DSM 20109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|296131514|ref|YP_003638764.1|
Domain Number 1 Region: 58-148
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.83e-24
Family Ribosomal protein L9 C-domain 0.00024
Further Details:      
 
Domain Number 2 Region: 3-58
Classification Level Classification E-value
Superfamily L9 N-domain-like 2.27e-16
Family Ribosomal protein L9 N-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|296131514|ref|YP_003638764.1|
Sequence length 149
Comment 50S ribosomal protein L9 [Cellulomonas flavigena DSM 20109]
Sequence
MAKIILTHEVTGLGAPGDVVEVKDGYARNYLVPRNLATPWTKGAEKNVSAIRRARKAREI
ATLDEAKAIRDSLQANPVTVSAKAGESGRLFGAVTTAEIASAITAAGAPAVDKRKIEVAQ
AIKSTGEYTVQVRLHPEVSAKVTVKVVAA
Download sequence
Identical sequences D5UE89
gi|296131514|ref|YP_003638764.1| WP_013118892.1.68649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]