SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302035416|ref|YP_003795738.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302035416|ref|YP_003795738.1|
Domain Number 1 Region: 10-241
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.2e-58
Family FAD-linked oxidases, N-terminal domain 0.0000000197
Further Details:      
 
Domain Number 2 Region: 243-513
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 2.83e-48
Family Vanillyl-alcohol oxidase-like 0.0000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302035416|ref|YP_003795738.1|
Sequence length 514
Comment 4-cresol dehydrogenase (hydroxylating) flavoprotein subunit [Candidatus Nitrospira defluvii]
Sequence
MASKFIALPKGVSEKTFEAAIAEFRSILGQDSVLVTAEQLAPYIKTMMPVPDADHTPSAA
LQATTVEQIQKIVAVCNKYKVPIWMISTGRNFGYGSAAPAERGQVVLDLKRMNRILEVDP
DLCFALVEPGVTYKQLYDYIQEHKYPLWLSCPAPSAIAGPTGNTLDRGVGYTPYGEHFLF
ACGMEVVLANGEVLRTGMGSLPKSNTWQVFKWGYGPYLDGIFTQSNYGIVTKFGFWLMPA
PPAFKPFVIQYENEDDIVEIVETIRPLRISGVIPNAIVIAHALYEAPTKAKRSDYVTGPG
AITDDAVRQIMKDHKLGVWNVYAALYGTQEQIDVNWKIVTDAFSKSGKAKVLTEQEAGDD
PAFQYRAALMRGDMTLKEFSLYNWRGGGGSMWFAPVSQARGSETLKQMAMTKRILGKYGL
DYSGEFIVGMRDMHHIVDVLYDKTDPAMTKAAYQCFDELLTEFSNEGYGTYRVNTAFMDK
VAHTYGPVQRHVHETLKKALDPNGILAPGKSGIR
Download sequence
Identical sequences D8P7G8
WP_013246640.1.3676 gi|302035416|ref|YP_003795738.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]