SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302035446|ref|YP_003795768.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302035446|ref|YP_003795768.1|
Domain Number 1 Region: 87-277
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 4.48e-44
Family Glyoxalase II (hydroxyacylglutathione hydrolase) 0.041
Further Details:      
 
Domain Number 2 Region: 20-71
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000609
Family Single 4Fe-4S cluster ferredoxin 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302035446|ref|YP_003795768.1|
Sequence length 291
Comment metallo-beta-lactamase superfamily hydrolase [Candidatus Nitrospira defluvii]
Sequence
MADARKRLDANRAGNFYVDSTCINCDACRQLAPSSFEEVGEYSAVTHQPATELETRQAYR
ALLACPTGSIGAEHTNHTLLSAANADFPLPIEGNVYYCGFNSEKSFGANSFFVQHPDGNW
LIDSPRYLKPLVDAFDRMGGLAHIFLTHEDDVAEAARYASRFGAERIIHRADVHAMPDAE
AIVEGTDARVYREEFRIIPVPGHTAGSMCLLYRDRFLFTGDHLWWDPEVRALNSPRQLVW
NASALFESIRTLAQYSFDWVLAGHGGRVQLPRLDMQAALHALIEGRRQGRA
Download sequence
Identical sequences D8P9D1
WP_013246670.1.3676 gi|302035446|ref|YP_003795768.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]