SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302035558|ref|YP_003795880.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302035558|ref|YP_003795880.1|
Domain Number 1 Region: 57-146
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 6.8e-25
Family Ribosomal protein L9 C-domain 0.00038
Further Details:      
 
Domain Number 2 Region: 1-56
Classification Level Classification E-value
Superfamily L9 N-domain-like 8.37e-16
Family Ribosomal protein L9 N-domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302035558|ref|YP_003795880.1|
Sequence length 161
Comment 50S ribosomal protein L9 [Candidatus Nitrospira defluvii]
Sequence
MKVILQETLEGVGDLGDLLDVSNGFARNYLLPRKKAVEANSRNIKEFEHAKRAAAEKAKK
EKQDIEAHGKKISAVSLTIAAQVGKDDKMFGSVTAKDIADGLAEQGFTVDRRKIQLAQPI
KELGTFAIAIKLPREVTATIAVHVVKKQEEQAEPEEAAPTA
Download sequence
Identical sequences D8P9P4
gi|302035558|ref|YP_003795880.1| WP_013246780.1.3676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]