SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302035577|ref|YP_003795899.1| from Candidatus Nitrospira defluvii

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|302035577|ref|YP_003795899.1|
Domain Number - Region: 5-83
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000582
Family Thioltransferase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302035577|ref|YP_003795899.1|
Sequence length 137
Comment hypothetical protein NIDE0189 [Candidatus Nitrospira defluvii]
Sequence
MAVYPLTVFYDGACPICAREMALMKRLDRTQRLTLLDFSLAGFAAPADLAVTDLSAVIHA
QWADGTVITGVEVFRAIWEAIGLGFLSRLSRLPLVAPLMVTAYGWFARNRLWLTGRSNAC
PGNACAAASPASIQAPQ
Download sequence
Identical sequences D8P9R3
WP_013246799.1.3676 gi|302035577|ref|YP_003795899.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]